DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and uba5

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001004790.1 Gene:uba5 / 448010 XenbaseID:XB-GENE-955661 Length:399 Species:Xenopus tropicalis


Alignment Length:415 Identity:79/415 - (19%)
Similarity:144/415 - (34%) Gaps:120/415 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ENLEFLQTKCQVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKA 104
            |:.|.::| ..|.::|.||:|....:.|...|.|.|.:.|.|.:|::|:||.| |:....|.||.
 Frog    62 EDYEKIRT-FTVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVEMANMNRLF-FQPHQAGLSKV 124

  Fly   105 ECAARFINARVPTCRVTPHFKKIQDFDESFYQQF---------------HLVVCGLDSIVARRWI 154
            |.|...:....|..:...|...|...|.  :|.|               .||:..:|:..||..|
 Frog   125 EAAEHTLRNINPDVQFEVHNYNITTLDN--FQHFMDRISKGGLKEGTPVDLVLSCVDNFEARMAI 187

  Fly   155 NGMLLSMLRYEEDGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTI 219
            |.....:::...:..:..:::           .|:.::|.||.|||..|.     |    ||...
 Frog   188 NTACNELVQIWMESGVSENAV-----------SGHIQLIKPGETACFACA-----P----PLVVA 232

  Fly   220 ANTPRLPEHCIEYVKIIQWEKQNPFGVPLDGDDPQHIGWIYERALERSNEFNITGVTYRLVQGVV 284
            ||                                     |.|:.|:|              :||.
 Frog   233 AN-------------------------------------IDEKTLKR--------------EGVC 246

  Fly   285 KHIIPAVASTNAAIAAACALEVFKLATSCYDSMANYLNFNDLDGIYTYTYEAEKSENC--LACSN 347
            ...:|   :|...:|......|.|...: :.:::.||.:|.:...:. |...:.:..|  ..|..
 Frog   247 AASLP---TTMGVVAGMLVQNVLKYLLN-FGTVSFYLGYNAMQDFFP-TMAMKPNPQCGDKYCRK 306

  Fly   348 TPQPLPIEDPNTTTLEDVIKLLCDSPRFQLKSPALTTVMKDGKRRTLYMSGVKSIEEATRKNLTQ 412
            ..:...:::......|.::          :|...:.....|.        |::.:.|.:.:.|..
 Frog   307 QQEEFKLKEAARPKQEPIV----------VKEEEIVHEDNDW--------GIELVSEVSEEELKA 353

  Fly   413 SLGEL-----GLHDGQQLTVTDATS 432
            :.|.:     |:.....:.:|:.||
 Frog   354 ASGPVPELPEGIKVAYTVPITEPTS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 46/186 (25%)
Uba3_RUB 50..346 CDD:238765 64/312 (21%)
E2_bind 357..442 CDD:285976 11/81 (14%)
uba5NP_001004790.1 ThiF_MoeB_HesA_family 48..293 CDD:238386 66/310 (21%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 331..343 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.