DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Aos1

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_650198.1 Gene:Aos1 / 41532 FlyBaseID:FBgn0029512 Length:337 Species:Drosophila melanogaster


Alignment Length:325 Identity:65/325 - (20%)
Similarity:120/325 - (36%) Gaps:99/325 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ENLEFLQTKCQVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKA 104
            |:.:.|:| .::||.|..|||.|:.|::.|.|..::.::|...:...:...|||..|..:..::|
  Fly    32 ESQKRLRT-AKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFLVPRESLNTNRA 95

  Fly   105 ECAARFINARVPTCRVTPHFKKIQDFDESFYQQFHLVVCGLDSIVARRWINGMLLSMLRYEEDGT 169
            |.:.....|..|...::...:.:::....|:.||.:||           :||     ...||...
  Fly    96 EASLTRARALNPMVDISADREPLKEKTSEFFGQFDVVV-----------VNG-----ATNEELLR 144

  Fly   170 IDT------SSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEH 228
            |||      ...:.....||.||          :.|.::        :.:|           .|.
  Fly   145 IDTICRDLGVKFIATDVWGTFGF----------YFASLQ--------KHSY-----------VED 180

  Fly   229 CIEYVKIIQWEKQNPF---GVPL--DGDDPQHIGWI--------YERALERS----------NEF 270
            .|::..:...||:..:   .:|.  |.|.|.:..|:        |.|.|:|:          .:|
  Fly   181 VIKHKVVANSEKKKKYETVSIPTQRDVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKF 245

  Fly   271 NIT---GVTYR-------LVQGVVKHIIP--------------AVASTNAAIAAACALEVFKLAT 311
            ..|   ..:|:       |::|:...::|              .::...|.:....|.||.|:.|
  Fly   246 RTTHKRDPSYKTREADLELLRGIRDELLPNSILGDEALGLIFAQISPAVAVVGGVVAQEVIKVVT 310

  Fly   312  311
              Fly   311  310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 37/177 (21%)
Uba3_RUB 50..346 CDD:238765 62/315 (20%)
E2_bind 357..442 CDD:285976
Aos1NP_650198.1 Aos1_SUMO 19..>172 CDD:238769 39/166 (23%)
ThiF 22..>167 CDD:279270 36/151 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446845
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.