DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and mocs3

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_956421.1 Gene:mocs3 / 393095 ZFINID:ZDB-GENE-040426-782 Length:459 Species:Danio rerio


Alignment Length:318 Identity:73/318 - (22%)
Similarity:108/318 - (33%) Gaps:95/318 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINARV 115
            ||::|.|||||.|.:.||..|.|.|.::|.|.:|||||:||.|......|..||..||:.|:...
Zfish    85 VLVVGCGGLGCPLAQYLAAAGIGRLGLLDYDVVELSNLHRQVLHTELTQGQPKALSAAQAISRMN 149

  Fly   116 PTCRVTP-HFKKIQDFDESFYQQFHLVVCGLDSIVARRWINGMLLSMLRYEEDGTIDTSSIVPMI 179
            .|.:..| |.:..::......||:.:|....|::..|..:|           |..:.||.  |::
Zfish   150 STVQCVPYHLQLSRENAIQLIQQYDIVADCSDNVPTRYLVN-----------DACVLTSR--PLV 201

  Fly   180 DGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEHCIEYVKIIQWEKQNPF 244
            .......:|...|.......|..|...:.||            |....:|.:             
Zfish   202 SASALRMEGQLTVYNYRGGPCYRCLYPIPPP------------PETVTNCSD------------- 241

  Fly   245 GVPLDGDDPQHIGWIYERALERSNEFNITGVTYRLVQGVVKHIIPAVASTNAAIAAACALEVFKL 309
                                                 |.|..::|.:      :....||||.|:
Zfish   242 -------------------------------------GGVLGVVPGI------MGCLQALEVLKI 263

  Fly   310 ATSCYDSMANYLNFNDLDGIYTYTYE---AEKSENCLACSNTPQPLPIEDPNTTTLED 364
            |:....|.|..|..  .||..|....   ..:.:.|:.|.        |.|..|.|:|
Zfish   264 ASGQECSFAQQLLM--FDGEQTRFRSIRLRSRQKECVVCG--------EKPTITELQD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 49/169 (29%)
Uba3_RUB 50..346 CDD:238765 67/298 (22%)
E2_bind 357..442 CDD:285976 4/8 (50%)
mocs3NP_956421.1 PRK07411 46..459 CDD:180967 73/318 (23%)
ThiF_MoeB_HesA_family 62..290 CDD:238386 66/287 (23%)
RHOD_ThiF 327..459 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.