DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Uba4

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001260255.1 Gene:Uba4 / 34187 FlyBaseID:FBgn0032054 Length:453 Species:Drosophila melanogaster


Alignment Length:314 Identity:77/314 - (24%)
Similarity:106/314 - (33%) Gaps:99/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINARV 115
            |||:|.|||||...:.||..|.|:|.::|.|.:|.||.:||.|......|.||||      :||:
  Fly    94 VLIVGLGGLGCPAAQYLAAAGCGHLGLVDYDEVERSNFHRQILHSEDRCGMSKAE------SARI 152

  Fly   116 PTCRVTPHFKKIQDFDESFY--------QQFHLVVCGLDSIVARRWINGMLLSMLRYEEDGTIDT 172
            ....:.||. :||......|        :.:.:|:...|::..|     .|||      |..:..
  Fly   153 ALLELNPHC-EIQCHSRMLYPHNAMHIIRGYDVVLDCTDNVPTR-----YLLS------DACVML 205

  Fly   173 SSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEHCIEYVKIIQ 237
            |.  |::.|......|...|.......|..|...:.||            |....:|        
  Fly   206 SK--PLVSGSALKMDGQLTVYNYANGPCYRCIFPVPPP------------PEAVTNC-------- 248

  Fly   238 WEKQNPFGVPLDGDDPQHIGWIYERALERSNEFNITGVTYRLVQGVVKHIIPAVASTNAAIAAAC 302
                        ||.                                 .::.||..|   |.|..
  Fly   249 ------------GDG---------------------------------GVLGAVTGT---IGAMQ 265

  Fly   303 ALEVFKLATSCYDSMA-NYLNFNDLDGIYTYTYEAEKSENCLACSNTPQPLPIE 355
            |||..|:.....|.:| ..|.|:...|::.......|..||..||  .|||..|
  Fly   266 ALEAIKVIVGMGDVLAGRLLIFDGGSGVFRNIRIRSKRPNCHMCS--AQPLITE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 50/176 (28%)
Uba3_RUB 50..346 CDD:238765 71/303 (23%)
E2_bind 357..442 CDD:285976
Uba4NP_001260255.1 PRK07878 56..453 CDD:181156 77/314 (25%)
ThiF_MoeB_HesA_family 71..299 CDD:238386 68/292 (23%)
RHOD_ThiF 336..453 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.