DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Uba5

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster


Alignment Length:402 Identity:95/402 - (23%)
Similarity:137/402 - (34%) Gaps:112/402 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAA---RFIN 112
            |.|:|.||:|......|...|.|.|.:.|.|.:||:|:||.| |.....|.||...||   .|||
  Fly    76 VAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANMNRLF-FTPDQAGLSKVAAAAATLSFIN 139

  Fly   113 ARVPTCRVTPH---FKKIQDFDESF----------YQQFHLVVCGLDSIVARRWINGMLLSM-LR 163
               |...:..|   ...:::||...          .|...||:..:|:..||..||...... |.
  Fly   140 ---PDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCVDNFEARMAINAACNERNLN 201

  Fly   164 YEEDGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEH 228
            :.|.|..:.:            ..|:.:.|.||.|||..|.    ||.|      :|..      
  Fly   202 WFESGVSENA------------VSGHIQFIRPGDTACFACA----PPLV------VAEN------ 238

  Fly   229 CIEYVKIIQWEKQNPFGVPLDGDDPQHIGWIYERALERSNEFNITGVTYRLVQGVVKHIIPAVAS 293
                                          |.|:.|:|              :||....:|....
  Fly   239 ------------------------------IDEKTLKR--------------EGVCAASLPTTMG 259

  Fly   294 TNAAIAAACALEVFKLATSCYDSMANYLNFNDLDGIY-TYTYEAE---KSENCLACSN----TPQ 350
            ..|......||:..    ..:..:::||.:|.|...: ..|.:..   ...|||....    .|:
  Fly   260 ITAGFLVQNALKYL----LNFGEVSDYLGYNALSDFFPKMTLKPNPQCDDRNCLVRQKEFQARPK 320

  Fly   351 PLPI------EDPNTTTLEDVIKLLCDSPRFQLKSPALTTVMKDGKRRTLYMSGVKSIEEATRKN 409
            |:.|      |:|...|.|..|:|:.:.......:||.|.||.:| .|..|.:..||.|.:....
  Fly   321 PVLIEEKAVSEEPLHATNEWGIELVAEDAPESNTTPAETPVMGEG-LRLAYEAPEKSSETSEETV 384

  Fly   410 LTQSLGELGLHD 421
            ...:..|..|.|
  Fly   385 SAATADETSLED 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 53/185 (29%)
Uba3_RUB 50..346 CDD:238765 72/315 (23%)
E2_bind 357..442 CDD:285976 19/65 (29%)
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 68/300 (23%)
ThiF 53..310 CDD:279270 71/313 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.