DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Uba1

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001014102.1 Gene:Uba1 / 314432 RGDID:1359327 Length:1058 Species:Rattus norvegicus


Alignment Length:258 Identity:77/258 - (29%)
Similarity:126/258 - (48%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEREGPFCKDG-FAASSENLEFLQTKCQVLIIGAGGLGCELLKDLALMGF-----GNLHVIDMDT 82
            |.|:..:  || .|....:|:....|.:..::|||.:||||||:.|::|.     |.:.|.||||
  Rat   445 LPRQNRY--DGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEVVVTDMDT 507

  Fly    83 IELSNLNRQFLFRRTDIGASKAECAARFINARVPTCRVTPHFKKI-----QDFDESFYQQFHLVV 142
            ||.||||||||||..|:...|::.||..:....|..:||.|..::     :.:|:.|:|....|.
  Rat   508 IEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPYIQVTSHQNRVGPDTERIYDDDFFQNLDGVA 572

  Fly   143 CGLDSIVARRWINGMLLSMLRYEEDGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDL 207
            ..||::.||.:::...:...:             |:::.||.|.|||.:|::|..|.....:.| 
  Rat   573 NALDNVDARMYMDRRCVYYRK-------------PLLESGTLGTKGNVQVVIPFLTESYSSSQD- 623

  Fly   208 FPPQVNYPLCTIANTPRLPEHCIEYVKIIQWEKQNPFGVPLDGDDPQHIGWIYERALERSNEF 270
             ||:.:.|:||:.|.|...||      .:||.:....|             ::::..|..|::
  Rat   624 -PPEKSIPICTLKNFPNAIEH------TLQWARDEFEG-------------LFKQPAENVNQY 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 62/181 (34%)
Uba3_RUB 50..346 CDD:238765 70/231 (30%)
E2_bind 357..442 CDD:285976
Uba1NP_001014102.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Ube1 49..1055 CDD:273603 77/258 (30%)
2 approximate repeats. /evidence=ECO:0000255 63..611 60/180 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.