DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Uba7

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001380849.1 Gene:Uba7 / 301000 RGDID:1308323 Length:990 Species:Rattus norvegicus


Alignment Length:351 Identity:96/351 - (27%)
Similarity:143/351 - (40%) Gaps:88/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EFLQTKCQVLIIGAGGLGCELLKDLALMGF-----GNLHVIDMDTIELSNLNRQFLFRRTDIGAS 102
            |.|..|..:|.:|||.:|||:||..||:|.     |.:.:.|||.:|.|||:||||||..|.|..
  Rat   415 EKLSYKHYLLQVGAGAIGCEMLKGFALVGLGVRDNGGVTIADMDHVERSNLSRQFLFRPKDTGRP 479

  Fly   103 KAECAARFINARVPTCRVTPHFKKIQD-----FDESFYQQFHLVVCGLDSIVARRWINGMLLSML 162
            |||.||...:...|..:||.|...:..     :|:.|:.:...||..|||..||.::.......|
  Rat   480 KAEVAAEAAHRLNPDLQVTSHTCPLDPTTEDIYDDDFFSRVDGVVAALDSFQARHYVAARCTHYL 544

  Fly   163 RYEEDGTIDTSSIVPMIDGGTEGFKGNARVILP-------GFTACIECTLDLFPPQVNYPLCTIA 220
            :             |:::.||:|.:|:|.|.:|       |.|:..|..         ||:||:.
  Rat   545 K-------------PLLEAGTQGTRGSASVFVPYVTEVYKGPTSAEEAP---------YPVCTLR 587

  Fly   221 NTPRLPEHCIEYVKIIQWEKQNPFGVPLDGDDPQHIGWIYERALERSNEF-----------NITG 274
            :.|...||.      :|| .|:.|    :|        ::..:.|..|::           :.||
  Rat   588 HFPSTVEHS------LQW-AQDEF----EG--------LFRLSAETINDYQQTCTSSLLGTDGTG 633

  Fly   275 VTYRLVQGVVKHIIPAVASTNAAIAAACALEVFKLATSCY-DSMANYLNFNDLDGIY---TYTYE 335
            :...|.|      :..|..|.......|.:........|: |::...|.....|.:.   |..:.
  Rat   634 ILALLQQ------VMGVLRTRPQTWQDCVVWALGHWQLCFRDNIVELLRKFPSDKVLEDGTLFWS 692

  Fly   336 AEKSENCLACSNTPQPLPIEDPNTTT 361
            ..|.     |   |.||.. |||..|
  Rat   693 GSKK-----C---PHPLQF-DPNQDT 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 63/188 (34%)
Uba3_RUB 50..346 CDD:238765 85/327 (26%)
E2_bind 357..442 CDD:285976 3/5 (60%)
Uba7NP_001380849.1 Ube1 1..988 CDD:273603 96/351 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.