DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Uba1y

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_030107423.1 Gene:Uba1y / 22202 MGIID:98891 Length:1087 Species:Mus musculus


Alignment Length:248 Identity:76/248 - (30%)
Similarity:120/248 - (48%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FNGLRNILEREGPFCKD-----------GFAASSENLEFLQTKCQVLIIGAGGLGCELLKDLALM 70
            |:.|..:.|....|.:|           ..|....:|:....|.:..::|||.:||||||:.|::
Mouse   425 FDALECLPEHRVAFMEDKCLPHQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMI 489

  Fly    71 GF-----GNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINARVPTCRVTPHFKKI--- 127
            |.     |.:.|.||||||.||||||||||..||...|:|.||..:....|..|:..|..::   
Mouse   490 GLGCGEDGEITVTDMDTIEKSNLNRQFLFRPWDITKLKSETAAAAVRDINPHIRIFSHQNRVGPE 554

  Fly   128 --QDFDESFYQQFHLVVCGLDSIVARRWINGMLLSMLRYEEDGTIDTSSIVPMIDGGTEGFKGNA 190
              ..:|:.|:|:...|...||::.||.:::...:...:             |:::.||.|.|||.
Mouse   555 TEHVYDDDFFQKLDGVANALDNVDARLYVDRRCVYYRK-------------PLLESGTLGTKGNV 606

  Fly   191 RVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEHCIE-----YVKIIQW 238
            :|::|..|.....:.|  ||:.:.|:||:.|.|...||.::     ..|:.:|
Mouse   607 QVVVPFLTESYSSSQD--PPEKSIPICTLKNFPNAIEHTVQGRLHALKKVARW 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 63/181 (35%)
Uba3_RUB 50..346 CDD:238765 68/204 (33%)
E2_bind 357..442 CDD:285976
Uba1yXP_030107423.1 Ube1 48..1084 CDD:273603 76/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.