DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Uba1

DIOPT Version :10

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_033483.3 Gene:Uba1 / 22201 MGIID:98890 Length:1058 Species:Mus musculus


Alignment Length:105 Identity:23/105 - (21%)
Similarity:39/105 - (37%) Gaps:17/105 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 CAVGKAKQTAKTEIEK--------LKLSDMSVKDLVLTAGKIIYQVHDE---LKDKDFKL----E 238
            |.....|....|::.|        :.|.|..:..|....|..| :||.|   |.:...:|    :
Mouse   647 CGAKDPKSLTSTQLRKQVATLCQIMNLKDNELDQLAKFMGHDI-RVHREYYRLSENTIQLAKVSK 710

  Fly   239 LSWVCQDSNGIHK-TVPAEVYAAANRAGQEAVDEDDSDNE 277
            |....:..:|::| ....|:..:.:..|:|.....|.|.|
Mouse   711 LLLSLEKGSGVYKGRSLEEIQFSTDVTGEELSQTTDMDEE 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 Uba3_RUB 50..346 CDD:238765 23/105 (22%)
E2_bind 357..442 CDD:462611
Uba1NP_033483.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
2 approximate repeats 63..611
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.