DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and Uba1

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_033483.2 Gene:Uba1 / 22201 MGIID:98890 Length:1118 Species:Mus musculus


Alignment Length:234 Identity:72/234 - (30%)
Similarity:117/234 - (50%) Gaps:44/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TKCQVLIIGAGGLGCELLKDLALMGF-----GNLHVIDMDTIELSNLNRQFLFRRTDIGASKAEC 106
            :|.:..::|||.:||||||:.|::|.     |.:.|.||||||.||||||||||..|:...|::.
Mouse   527 SKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEVVVTDMDTIEKSNLNRQFLFRPWDVTKLKSDT 591

  Fly   107 AARFINARVPTCRVTPHFKKI-----QDFDESFYQQFHLVVCGLDSIVARRWINGMLLSMLRYEE 166
            ||..:....|..:||.|..::     :.:|:.|:|....|...||:|.||.:::...:...:   
Mouse   592 AAAAVRQMNPYIQVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNIDARMYMDRRCVYYRK--- 653

  Fly   167 DGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEHCIE 231
                      |:::.||.|.|||.:|::|..|.....:.|  ||:.:.|:||:.|.|...||   
Mouse   654 ----------PLLESGTLGTKGNVQVVIPFLTESYSSSQD--PPEKSIPICTLKNFPNAIEH--- 703

  Fly   232 YVKIIQWEKQNPFGVPLDGDDPQHIGWIYERALERSNEF 270
               .:||.:....|             ::::..|..|::
Mouse   704 ---TLQWARDEFEG-------------LFKQPAENVNQY 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 63/181 (35%)
Uba3_RUB 50..346 CDD:238765 71/231 (31%)
E2_bind 357..442 CDD:285976
Uba1NP_033483.2 ThiF 109..1115 CDD:330201 72/234 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.