DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and aos-1

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_505604.2 Gene:aos-1 / 179409 WormBaseID:WBGene00000142 Length:350 Species:Caenorhabditis elegans


Alignment Length:295 Identity:64/295 - (21%)
Similarity:103/295 - (34%) Gaps:92/295 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARF---- 110
            :|||||...||.|:.|.|:|.|...:|::|...::...:...||:..:...:...:.||.:    
 Worm    37 KVLIIGGKQLGAEVAKTLSLAGVDEMHLVDHRLVDTEEIGMNFLYDASVDNSKMTKWAASYNFLY 101

  Fly   111 -INARVPTCRVTPHFKKIQDFD-ESFYQQFHLVVCGLDSIVAR-------------RWINGMLLS 160
             :|..|....|........|.: |.:..:|.|||. ||....|             |:|:|.:..
 Worm   102 NLNRNVKLFIVEEDVLSKNDSEIEEYLTKFTLVVV-LDESYERTAKVNNICRKHHIRFISGAIYG 165

  Fly   161 MLRY----------------------EEDGTIDTSSIVPMIDGGTEGFKGNARVILPGFTACIEC 203
            .:.|                      ||..|..||::|                     |...|.
 Worm   166 WIGYAFFDFDGHAYLVKAKSPDCLNEEESETGKTSTVV---------------------TVDEEF 209

  Fly   204 TLDLFPPQVNYP-LCTIANTPRLPEHCIEYVKIIQWEKQNPFGVPLDGDDPQHIGWIYERALERS 267
            .|:.|    :|| .....|:....:..:...|.|         ||..       .::.:..|..|
 Worm   210 VLETF----SYPSFVETLNSDFTAKKIVRKCKRI---------VPTS-------YFLVKSMLRAS 254

  Fly   268 NEFNITGVTYRLVQGVVKHIIP----AVASTNAAI 298
            :|..:||||    :..::.:||    .||:.|..|
 Worm   255 SENKLTGVT----ENDIEKLIPIWNEEVAAGNHTI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 46/211 (22%)
Uba3_RUB 50..346 CDD:238765 64/295 (22%)
E2_bind 357..442 CDD:285976
aos-1NP_505604.2 E1-1_like 17..345 CDD:238762 64/295 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.