DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and rfl-1

DIOPT Version :10

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_498534.2 Gene:rfl-1 / 175982 WormBaseID:WBGene00004341 Length:430 Species:Caenorhabditis elegans


Alignment Length:107 Identity:23/107 - (21%)
Similarity:44/107 - (41%) Gaps:22/107 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLYEP-DCGTRIFTIDTSIGMAISGMITDGRAVVDIARQEAASYRQQNNRPIPLKQLNDRLSSYF 120
            ||::. .|...||.:|..:.:..|..:           ||..    ::::...|::...:||:  
 Worm    12 KLHQQVQCKDEIFCLDQKVNVRRSLQV-----------QETV----EDHQSFALEEEEQQLST-- 59

  Fly   121 HAYTLYSAVRPFGVSVILASWSEEKGPEMYMIDPSGVSCVSL 162
             ...|.....||   :.:...||:..|.:...|||.::.:||
 Worm    60 -PSLLQDTTIPF---LQMLQQSEDPSPFLSFKDPSFLALLSL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 Uba3_RUB 50..346 CDD:238765 23/107 (21%)
E2_bind 357..442 CDD:462611
rfl-1NP_498534.2 Uba3_RUB 44..341 CDD:238765 14/60 (23%)
E2_bind 349..429 CDD:462611
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.