DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and ATG7

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006712994.1 Gene:ATG7 / 10533 HGNCID:16935 Length:738 Species:Homo sapiens


Alignment Length:378 Identity:77/378 - (20%)
Similarity:134/378 - (35%) Gaps:112/378 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LQTKCQVLIIGAGGLGCELLKDLALMGFGNLHV--IDMDTIELSNLNRQFLFRRTDI---GASKA 104
            :..||  |::|||.|||.:.:  .|||:|..|:  :|...|..||..||.|:...|.   |..||
Human   354 VSVKC--LLLGAGTLGCNVAR--TLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKA 414

  Fly   105 ECA------------ARFINARVPTCRVTPHFKKI------QDFDESFYQQF---HLVVCGLDSI 148
            ..|            ||..|..:|......:|..:      :|.::  .:|.   |.||..|...
Human   415 LAAADRLQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQ--LEQLIESHDVVFLLMDT 477

  Fly   149 VARRWINGMLLS-----------------MLRY-----EEDGTIDTSSIVPMIDGGTEGFKGNAR 191
            ...||:..::.:                 ::|:     ::.|..|.....|:......|....|.
Human   478 RESRWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLFAN 542

  Fly   192 VILPGF-TACIEC-------------TLDLFPPQVNYPLCTIANTPRLP----EHCIEYVKIIQW 238
            :  ||: ..|..|             |||        ..||::. |.|.    ...:|.:..:..
Human   543 I--PGYKLGCYFCNDVVAPGDSTRDRTLD--------QQCTVSR-PGLAVIAGALAVELMVSVLQ 596

  Fly   239 EKQNPFGVPLDGDDPQHIGWIYERALERSNEFNIT-GVTYRLVQGVVK---HIIPAVASTNAAIA 299
            ..:..:.:....||             |.||...: |:....::|.:.   :::|...:.:.  .
Human   597 HPEGGYAIASSSDD-------------RMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDK--C 646

  Fly   300 AACALEV--------FKLATSCYDSMANYLNFNDLDGIYTYTYEAEKSENCLA 344
            .||:.:|        |......::|..::|  .||.|:.....|.:.:|:.|:
Human   647 TACSSKVLDQYEREGFNFLAKVFNSSHSFL--EDLTGLTLLHQETQAAEDHLS 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 54/233 (23%)
Uba3_RUB 50..346 CDD:238765 75/373 (20%)
E2_bind 357..442 CDD:285976
ATG7XP_006712994.1 ATG7_N 13..321 CDD:293029
E1_like_apg7 15..693 CDD:273590 75/372 (20%)
Apg7 357..682 CDD:238763 73/358 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.