DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uba3 and SAE1

DIOPT Version :9

Sequence 1:NP_610913.1 Gene:Uba3 / 36539 FlyBaseID:FBgn0263697 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_005491.1 Gene:SAE1 / 10055 HGNCID:30660 Length:346 Species:Homo sapiens


Alignment Length:327 Identity:87/327 - (26%)
Similarity:118/327 - (36%) Gaps:94/327 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QVLIIGAGGLGCELLKDLALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINAR 114
            :||::|..|||.|:.|:|.|.|...|.::|.:.:...:...|||.|...:|.::||.:.......
Human    38 RVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNL 102

  Fly   115 VPTCRVTPHFKKIQDFDESFYQQFH---LVVCGLDSIVARRWINGMLLSMLRYEEDGTIDTSSIV 176
            .|...|....:.|:...|||:.||.   |..|..|.||               :.|.....:|| 
Human   103 NPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV---------------KVDQICHKNSI- 151

  Fly   177 PMIDGGTEGFKGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEHCIEYV-------K 234
            ....|...|:.|                            .|.||   |.||  |:|       |
Human   152 KFFTGDVFGYHG----------------------------YTFAN---LGEH--EFVEEKTKVAK 183

  Fly   235 IIQWEKQNPFGVPLDGDDPQHIGWIYERALERSNEFNITGVTYRLVQGVVKHIIPAVASTNAAIA 299
            :.|       ||. ||.|.       :||...|:|  .|.|..::|...||..:....|:..|.|
Human   184 VSQ-------GVE-DGPDT-------KRAKLDSSE--TTMVKKKVVFCPVKEALEVDWSSEKAKA 231

  Fly   300 AACALEVFKLATSCYDSMANYLNFNDLDG--IYTYTYEAEKSENCLACSN--------TPQPLPI 354
            |      .|..||.|..:...|.|....|  ..:.||| |.||..|...|        :|..|| 
Human   232 A------LKRTTSDYFLLQVLLKFRTDKGRDPSSDTYE-EDSELLLQIRNDVLDSLGISPDLLP- 288

  Fly   355 ED 356
            ||
Human   289 ED 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uba3NP_610913.1 ThiF 48..>220 CDD:279270 40/172 (23%)
Uba3_RUB 50..346 CDD:238765 81/307 (26%)
E2_bind 357..442 CDD:285976 87/327 (27%)
SAE1NP_005491.1 Aos1_SUMO 16..341 CDD:238769 87/327 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.