DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stk32c and S6k

DIOPT Version :9

Sequence 1:NP_001102392.1 Gene:Stk32c / 365381 RGDID:1305864 Length:488 Species:Rattus norvegicus
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:336 Identity:103/336 - (30%)
Similarity:173/336 - (51%) Gaps:32/336 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat    94 FQILRAIGKGSFGKVCIVQK---RDTEKMYAMKYMNKQQCI-ERDEVRNVFRELEILQEIEHVFL 154
            |::.:.:|||.:|||..|:|   ||..|.:|||.:.|...: .:.:..:...|..||:.::|.|:
  Fly    77 FELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFI 141

  Rat   155 VNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVQFSEDTVRLYICEMALALDYLRSQHIIHRDVK 219
            |.|.|:||.:..::::::.|.||:|..||::...|.|||...|:.|:.|||.:|....||:||:|
  Fly   142 VELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLK 206

  Rat   220 PDNILLDEQGHAHLTDFNIA-TIIKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVG 283
            |:|||||.|||..||||.:. ..|::|.......||..||||||...     :|:...|||||:|
  Fly   207 PENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTR-----SGHGKAVDWWSLG 266

  Rat   284 VMAYELLRGWRPYDIHS-SNAVESLVQLFSTVSVQYVPTWSKGMVALLRKLLTVNPEHRFSSLQD 347
            .:.:::|.|..|:...: ...:|::::....:.....|. ::.:|..|.|  ...|:...|..:|
  Fly   267 ALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPE-ARDLVRRLMK--RQEPQRLGSGPED 328

  Rat   348 ---MQTAPSLAHVLWDELSEKKVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSR 409
               :|..|...||.||::..:::||...|               ::.....:.:...|..:....
  Fly   329 AAAVQIHPFFKHVNWDDVLARRLEPPIKP---------------LLRSEDDVSQFDTRFTRQIPV 378

  Rat   410 DSSRDSSQSEN 420
            ||..|::.||:
  Fly   379 DSPDDTTLSES 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Stk32cNP_001102392.1 STKc_Yank1 93..352 CDD:270730 89/266 (33%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 103/336 (31%)
STKc_p70S6K 81..402 CDD:270736 102/332 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.