DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and ARHGAP32

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001364953.1 Gene:ARHGAP32 / 9743 HGNCID:17399 Length:2101 Species:Homo sapiens


Alignment Length:569 Identity:109/569 - (19%)
Similarity:186/569 - (32%) Gaps:189/569 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SITHSEDDF-------LDVRTSKSWREHRPSLPKN-QIPSVGNKRSRLSTGLNGSM------SGT 207
            |:...||||       :..|....|.|...::.:. .:|.:....:..:.|...||      ..|
Human    44 SVHSEEDDFVPELHRNVHPRERPDWEETLSAMARGADVPEIPGDLTLKTCGSTASMKVKHVKKST 108

  Fly   208 TP-------------TTGKSRRSS----------------VGIGVEQHTVDVGQGAERFCATTKV 243
            ||             |.|...:.:                :.:..||:.| :..|.|.......|
Human   109 TPGLMGCDNIHRLPFTKGHFPKMAECAHFHYENVEFGSIQLSLSEEQNEV-MKNGCESKELVYLV 172

  Fly   244 TIPQDGQGVIRAESTIESLPVIAGN------ERIGDGLSSTPRRSVLKEATAPPLTPVNAMAPHV 302
            .|...|:..| .:.:.|...|:..:      :|....||..||...||::.......:.|....:
Human   173 QIACQGKSWI-VKRSYEDFRVLDKHLHLCIYDRRFSQLSELPRSDTLKDSPESVTQMLMAYLSRL 236

  Fly   303 VAESGTPLQHRPLMRNHTFSQKTFLRGDN-----CVQCQKRIRFGAVGLRCRDCPVRCHIDCRYL 362
            .|.:|..:...|.:        |::..||     .|..:..|...|||        ..|:..||.
Human   237 SAIAGNKINCGPAL--------TWMEIDNKGNHLLVHEESSINTPAVG--------AAHVIKRYT 285

  Fly   363 ------LTVS---------------------------------C-------VPQTGT-----PTT 376
                  ||:.                                 |       |||:.|     |.:
Human   286 ARAPDELTLEVGDIVSVIDMPPKVLSTWWRGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVS 350

  Fly   377 K---TMTGYVTDFAPSIAPM-----------------------------IPALIVHCVNEIEARG 409
            |   .:..::..|..| .|.                             :|.::..|...||..|
Human   351 KKHGKLITFLRTFMKS-RPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYG 414

  Fly   410 LTEVGLYRLSSSEREYKALKEQFLRGKATPHLGN----TDIYVLCCCVKDFLRSLTEPLIPTSQW 470
            :.: |:||||......:.|:.:| ..:..|.|..    .||:.:....|.:.|.|..||:....:
Human   415 IVD-GIYRLSGVASNIQRLRHEF-DSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLY 477

  Fly   471 KDFANAVQNPDTKTAQDMLVK---SVKQLPQANRDTLAFLILHFQRIAQ-CPVVLMPIDNISLIF 531
            :.|::||   ...|.::.|:|   .::|||..:..||.||:.|...:|. |.:..|...|:::::
Human   478 EKFSDAV---SAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVW 539

  Fly   532 GPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLELPVSFWE---QYIVID 577
            .|.::                 ..||:..|......:|.|   |.:|::
Human   540 APNLL-----------------RSKQIESACFSGTAAFMEVRIQSVVVE 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 13/91 (14%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 46/225 (20%)
ARHGAP32NP_001364953.1 PX_RICS 141..255 CDD:132831 23/123 (19%)
SH3_ARHGAP32_33 277..330 CDD:212769 5/52 (10%)
RhoGAP_CdGAP 382..576 CDD:239849 47/212 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 832..872
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 941..1052
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1117..1157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1183..1271
Interaction with GAB2. /evidence=ECO:0000269|PubMed:12819203 1405..1725
Interaction with FYN. /evidence=ECO:0000269|PubMed:12788081 1699..2101
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1812..1910
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.