DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and ARHGAP18

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_277050.2 Gene:ARHGAP18 / 93663 HGNCID:21035 Length:663 Species:Homo sapiens


Alignment Length:503 Identity:109/503 - (21%)
Similarity:195/503 - (38%) Gaps:104/503 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ARRQAEHERDAMESKIMAVADLLRHERNLNNETRDKLAFL-HTLPSSRKRKSLNAVRED------ 140
            :||..::..: .||..:.|.:....:|:::.::.|:|:.. :.:.....:||....:||      
Human    38 SRRYGQYTMN-QESTTIKVMEKPPFDRSISQDSLDELSMEDYWIELENIKKSSENSQEDQEVVVV 101

  Fly   141 -----------------------KSYGDINSTGSLLSDLSITHSEDDFLDVRT-SKSWREHRPSL 181
                                   :|.||...:...||.|:.|.:......|.| |::.|:     
Human   102 KEPDEGELEEEWLKEAGLSNLFGESAGDPQESIVFLSTLTRTQAAAVQKRVETVSQTLRK----- 161

  Fly   182 PKN---QIPSV----GNKRSRLSTGLNGSMSGTTPTT-----GKSRRSSVGIGVEQHTVDVGQGA 234
             ||   |||.|    ..:|....|...|:.|.:..|.     |:...:|..:|.|:........|
Human   162 -KNKQYQIPDVRDIFAQQRESKETAPGGTESQSLRTNENKYQGRDDEASNLVGEEKLIPPEETPA 225

  Fly   235 ERFCATTKVTIPQDGQGVIRAESTIESLPVIAGNERIGDGLSSTPRRSVLKEATAPPLTPVNAMA 299
            .......:|:..:  |.:.:.||:.|.:....|::      ::.|...:.|:.|.  .|.:..:|
Human   226 PETDINLEVSFAE--QALNQKESSKEKIQKSKGDD------ATLPSFRLPKDKTG--TTRIGDLA 280

  Fly   300 PHVVAESGTPLQHRPLMRNHTFSQKTFLRGDNCVQCQKRIRFGAVGLRCRDCPVRCHIDCRYLLT 364
            |..:.:    :.|..|:      :.|.|.....::.:::   .||.::.:|.            .
Human   281 PQDMKK----VCHLALI------ELTALYDVLGIELKQQ---KAVKIKTKDS------------G 320

  Fly   365 VSCVPQTGTPTTKTMTGYVTDFAPSIAPM-IPALIVHCVNEIEARGLTEVGLYRLSSSEREYK-- 426
            :.|||         :|..:......:..| ||.:....::.||.|||...||.|:..:....|  
Human   321 LFCVP---------LTALLEQDQRKVPGMRIPLIFQKLISRIEERGLETEGLLRIPGAAIRIKNL 376

  Fly   427 --ALKEQFLRGKATPHLGNTDIYVLCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQ-DM 488
              .|:.:|..|  |.:..:...:.....:|.|:|.|.:||:.....|.| .||||..||..| ..
Human   377 CQELEAKFYEG--TFNWESVKQHDAASLLKLFIRELPQPLLSVEYLKAF-QAVQNLPTKKQQLQA 438

  Fly   489 LVKSVKQLPQANRDTLAFLILHFQRIAQCPVV-LMPIDNISLIFGPTI 535
            |...|..||.||||||..|:...||:...... .|.:.|::::..|.:
Human   439 LNLLVILLPDANRDTLKALLEFLQRVIDNKEKNKMTVMNVAMVMAPNL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 5/47 (11%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 47/162 (29%)
ARHGAP18NP_277050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..37
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..227 10/47 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..277 8/41 (20%)
RhoGAP_ARHGAP18 321..534 CDD:239856 51/178 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.