DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and SYDE2

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_016857972.1 Gene:SYDE2 / 84144 HGNCID:25841 Length:1262 Species:Homo sapiens


Alignment Length:194 Identity:64/194 - (32%)
Similarity:90/194 - (46%) Gaps:25/194 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 SIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLR-GKATPHLGN--TDIYVLC 450
            :|..|:|.||..|:.|||.||...||||||..|....|.|:|.|.| .||.....|  .||.|:.
Human  1023 NIGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVIT 1087

  Fly   451 CCVKDFLRSLTEPLI------------PTSQWKDFANAVQNP--DTKTAQDMLVKSVKQLPQANR 501
            ..:||:||.|..|||            ..|..|..:|..:|.  |:|...|:|    ..||:..:
Human  1088 GVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGDSKYTVDLL----DCLPEIEK 1148

  Fly   502 DTLAFLILHFQRIAQC-PVVLMPIDNISLIFGPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLE 564
            .||..|:.|.:.:|.. .|..|...|:::.|||.::. ...:|..|  ...|||..:.:.:.|:
Human  1149 ATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLS-QRQEPSTH--NNRVFTDSEELASALD 1209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996
RhoGAP_MgcRacGAP 381..570 CDD:239847 64/194 (33%)
SYDE2XP_016857972.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.