DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and Chn2

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_114473.2 Gene:Chn2 / 84031 RGDID:620140 Length:468 Species:Rattus norvegicus


Alignment Length:312 Identity:81/312 - (25%)
Similarity:136/312 - (43%) Gaps:29/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 ERIGDGLSSTPRRSVLKEATAPPLTPVNAMAPHVVAESGTPL-QHRPLMRNHTFSQKTFLRGDN- 331
            |::...||.:...|.....|....|||..::..|...:.|.. .|....:.|.|...|| ||.: 
  Rat   164 EKVSRRLSRSKNESRKAGVTHEEHTPVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTF-RGPHW 227

  Fly   332 CVQCQKRIRFG--AVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYVTDFAPSI---- 390
            |..| ....:|  |.|:||.||.:..|..|...:...|.|.    ..:....|..|....:    
  Rat   228 CEYC-ANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPD----LKRIKKVYCCDLTTLVKAHN 287

  Fly   391 --APMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLR-GKATPHLGN--TDIYVLC 450
              .||:..:   |:.|||||||...||||:|......:.:|..|.| |:......|  .||.::.
  Rat   288 TQRPMVVDI---CIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIIT 349

  Fly   451 CCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIA 515
            ..:|.:.|.|..|:|....:..|..|.:..:.....:.:.:.:..||.|:.:||.:|::|.:::.
  Rat   350 GALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVT 414

  Fly   516 QCPV-VLMPIDNISLIFGPTIVGYSTPDPDQHAIYT--EVFTQKQVMKALLE 564
            .... .||..:|:.::||||::    ..|:...:.|  ::..||.:::.|:|
  Rat   415 MNEKDNLMNAENLGIVFGPTLM----RPPEDSTLTTLHDMRYQKLIVQILIE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 17/50 (34%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 51/196 (26%)
Chn2NP_114473.2 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_betaCHN 210..270 CDD:410407 19/65 (29%)
RhoGAP_chimaerin 275..468 CDD:239837 51/195 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.