DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and Chn1

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_038961900.1 Gene:Chn1 / 84030 RGDID:620139 Length:580 Species:Rattus norvegicus


Alignment Length:297 Identity:79/297 - (26%)
Similarity:133/297 - (44%) Gaps:34/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 LSSTPRRSVLKEATAPPLTPVNAMAPHVVAESGTPLQHRPLMRNHTFSQKTFLRGDN-CVQCQKR 338
            |:|..||:.|||         |...|             ...:.|.|...|| ||.: |..| ..
  Rat   305 LTSLVRRATLKE---------NEQIP-------------KYEKVHNFKVHTF-RGPHWCEYC-AN 345

  Fly   339 IRFG--AVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYVTDFAPSIAPMIPALIVHC 401
            ..:|  |.|::|.||.:..|..|..::...|.|.. ....|..:..:|....:.....|.::..|
  Rat   346 FMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDL-KHVKKVYSCDLTTLVKAHITKRPMVVDMC 409

  Fly   402 VNEIEARGLTEVGLYRLSSSEREYKALKEQFLR-GKATPHLGN--TDIYVLCCCVKDFLRSLTEP 463
            :.|||:|||...||||:|......:.:|..|.| |:......|  .||.::...:|.:.|.|..|
  Rat   410 IREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIP 474

  Fly   464 LIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIA-QCPVVLMPIDNI 527
            ||....:..|..:.:..|.....:.|.::::.||.|:.:||.:|:.|.:|:. .....||..:|:
  Rat   475 LITYDAYPKFIESAKIVDPDEQLETLHEALRSLPPAHCETLRYLMAHLKRVTLHEKENLMSAENL 539

  Fly   528 SLIFGPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLE 564
            .::||||::  .:|:.|..|...::..|:.|::.|::
  Rat   540 GIVFGPTLM--RSPELDPMAALNDIRYQRLVVELLIK 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 16/50 (32%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 51/188 (27%)
Chn1XP_038961900.1 SH2_a2chimerin_b2chimerin 163..249 CDD:198215
C1_alphaCHN 322..378 CDD:410406 17/57 (30%)
RhoGAP_chimaerin 387..580 CDD:239837 51/190 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.