DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and ARHGAP28

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001353159.1 Gene:ARHGAP28 / 79822 HGNCID:25509 Length:729 Species:Homo sapiens


Alignment Length:539 Identity:113/539 - (20%)
Similarity:186/539 - (34%) Gaps:154/539 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GDINSTG-SLLSDLSIT---------HSEDDFLDVRTSKSWREHRPSLPKNQIP---SVGNKRSR 195
            ||....| :|||.|:.|         |:....:..:..:|.|:.|.....::.|   :.||..::
Human   128 GDEEEDGKALLSTLTRTQAAAVQKRYHTYTQTMRKKDKQSIRDVRDIFGVSESPPRDTCGNHTNQ 192

  Fly   196 L-STGLNGSMSGTTPTTGKSRRSSVGIGVEQHTVDVGQGAERFCATTKVTIPQDGQG---VIRAE 256
            | .|.....:.....|:| |......:.                :||.....||.:|   |.|::
Human   193 LDGTKEERELPRVIKTSG-SMPDDASLN----------------STTLSDASQDKEGSFAVPRSD 240

  Fly   257 ST--IESLPVIAGNERIGDGLSSTPRRSVLKEATAPPLTPV-NAMAPHVVAESGTPLQHRPLMRN 318
            |.  :|::||:                .|....:..|..|| ||::.....|...|.:...|...
Human   241 SVAILETIPVL----------------PVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFE 289

  Fly   319 HTFS-----------------------------QKTFL----RGDNCVQCQKRIR---------- 340
            .::|                             |||..    .||...:..|:||          
Human   290 VSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGLTEAGDLSAEDMKKIRHLSLIELTAF 354

  Fly   341 FGAVGLRC----------RDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYVTDFAPSIAPMIP 395
            |.|.|::.          ||..:                 .|.|.|..:.|   |........:|
Human   355 FDAFGIQLKRNKTEKVKGRDNGI-----------------FGVPLTVLLDG---DRKKDPGVKVP 399

  Fly   396 ALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDIY---VLC-----CC 452
            .::.....::|..||...|::|||....:.|..:|: |..|.     |.|.:   .:|     ..
Human   400 LVLQKFFEKVEESGLESEGIFRLSGCTAKVKQYREE-LDAKF-----NADKFKWDKMCHREAAVM 458

  Fly   453 VKDFLRSLTEPLIPTSQWKDFANAVQ-NPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQR-IA 515
            :|.|.|.|...|.|......|.:.:: .|..|.....|...|..||.||||....|:..|.: ||
Human   459 LKAFFRELPTSLFPVEYIPAFISLMERGPHVKVQFQALHLMVMALPDANRDAAQALMTFFNKVIA 523

  Fly   516 QCPVVLMPIDNISLIFGPTIVGYSTPDPDQHAIYTEVF---TQKQVMKALLELPVSFWE--QYIV 575
            ......|.:.|||.:..|.:. :|.   .:|:.|.|:.   |...:::.:|:.....|:  .:::
Human   524 NESKNRMSLWNISTVMAPNLF-FSR---SKHSDYEELLLANTAAHIIRLMLKYQKILWKVPSFLI 584

  Fly   576 IDPTR-TPATVI--KRVPS 591
            ....| ..||::  |::||
Human   585 TQVRRMNEATMLLKKQLPS 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 14/100 (14%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 49/201 (24%)
ARHGAP28NP_001353159.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..105
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..236 13/76 (17%)
RhoGAP_ARHGAP18 377..588 CDD:239856 53/240 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 612..631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.