DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and ARHGAP9

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001306779.2 Gene:ARHGAP9 / 64333 HGNCID:14130 Length:750 Species:Homo sapiens


Alignment Length:664 Identity:125/664 - (18%)
Similarity:207/664 - (31%) Gaps:251/664 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DLRRCMQVLTDGTPEEEFLRFLRMFEQYHEKCAG-----------------------------YA 46
            |||||.:....| |....|:.|..:||:.:..:|                             ..
Human   196 DLRRCPRSPPPG-PACPLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNPGSMEG 259

  Fly    47 AETARIQNEL----------DKSLTKMGDLEGKLFHARRIIDME---IKARRQ----AEHERDAM 94
            .:|.:..|::          |....:..|.:|.|..::|...::   ::|.|.    .:...:..
Human   260 TQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVE 324

  Fly    95 ESKIMAVADLLRHERNLNNE--------TRDKLAFLH----TLPSSRKRKSLNAVREDKSYGDIN 147
            :|.::.:..:.:..|.|...        |.:.|.|..    |.|||             .:|...
Human   325 KSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSS-------------GWGPAG 376

  Fly   148 STGSLLSDL---SITH-----SEDDFLDVRTSKS-----------------------------WR 175
            |......||   ::.|     |..:.|.:||...                             |.
Human   377 SRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLVRWV 441

  Fly   176 EHRPSLPKNQIPSVGNKRSRLSTGLNGSMSGTTPTTGKSRRSSVGIGVEQHTVDVGQGAERFCAT 240
            |.|...|..:....|::.:.|...|:||        |.:..|:            |:..|.    
Human   442 EARREAPTGRDQGSGDRENPLELRLSGS--------GPAELSA------------GEDEEE---- 482

  Fly   241 TKVTIPQDGQGVIRAESTIESLPVIAGNERIG-----DGLSSTPRRSVLKE--ATAPPLTPVNAM 298
                           ||.:.|.|::..:.|..     :|......|:.||.  |..|||      
Human   483 ---------------ESELVSKPLLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPL------ 526

  Fly   299 APHVVAESGTPLQHRPLMRNHTFSQKTFLRGDNCVQCQKRIRFGAVGLRCRDCPVRCHIDCRYLL 363
                     ..||.|.|:|:..|.            ||                          |
Human   527 ---------QSLQERGLLRDQVFG------------CQ--------------------------L 544

  Fly   364 TVSCVPQTGTPTTKTMTGYVTDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKAL 428
            ...|..:..|                    :|:.:..|:..::.|||...|:||:|.:....:.|
Human   545 ESLCQREGDT--------------------VPSFLRLCIAAVDKRGLDVDGIYRVSGNLAVVQKL 589

  Fly   429 KEQFLRGKATPHLGN--------------------TDIYVLCCCVKDFLRSLTEPLIPTSQWKDF 473
            :....|.:|....|.                    .||:|:...:|.|||.|.:||:|......|
Human   590 RFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTEWDDIHVVTGALKLFLRELPQPLVPPLLLPHF 654

  Fly   474 ANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQR-IAQCPVVLMPIDNISLIFGPTIV- 536
            ..|:...:::.....:.:.:..:|:.|.|||.:|:.|..| ||......|...|:.::||||:. 
Human   655 RAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFR 719

  Fly   537 -GYSTPDPDQHAIY 549
             ...|.||..||:|
Human   720 PEQETSDPAAHALY 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 4/47 (9%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 48/192 (25%)
ARHGAP9NP_001306779.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..187
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..319 9/76 (12%)
Lipid binding 342..345 0/2 (0%)
Lipid binding 397..399 0/1 (0%)
Lipid binding 432..669 63/348 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 446..488 12/80 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.