DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and ARHGAP21

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_011517904.1 Gene:ARHGAP21 / 57584 HGNCID:23725 Length:1992 Species:Homo sapiens


Alignment Length:614 Identity:133/614 - (21%)
Similarity:224/614 - (36%) Gaps:162/614 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RRQAEHERDAMESKIMAVADLLRHERN------LNNETRD-KLAFLHTLPSSRKRKSLNAVREDK 141
            |||..|:.:::....:......:.||:      |::...| ||:|.|.    ...|.:......|
Human   887 RRQLSHDHESVGPPSLDAQPNSKTERSKSYDEGLDDYREDAKLSFKHV----SSLKGIKIADSQK 947

  Fly   142 SYGDINSTGSLLSDLSITHSEDDFLDVR---TSKS---------WREHRPSLPKNQIPSVGNKRS 194
            |..|..|.....|::....:::.:|..|   |.|.         |::....|..:.:....:||.
Human   948 SSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMYVVLRGHSLYLYKDKRE 1012

  Fly   195 RLSTGLNGSMSGTTPTTGKSRRSSVGIGVEQHTVDVGQGAER----FCATTKVTIPQDGQGVIRA 255
            :           |||:     .....|.|....:|:.....:    |..||     .|.:.:.:|
Human  1013 Q-----------TTPS-----EEEQPISVNACLIDISYSETKRKNVFRLTT-----SDCECLFQA 1056

  Fly   256 ESTIESLPVIAG-------NE-------------RI---------GDGLSSTPRRSV-----LKE 286
            |...:.|..|..       ||             ||         .:.|..|||:|:     |..
Human  1057 EDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNLMSKAEQLPKTPRQSLSIRQTLLG 1121

  Fly   287 ATAPPLTPVNAMAPHVVAESGTPLQHRPLMRNHTFSQK---TFLRGDNCVQC----QKRIRFGAV 344
            |.:.|.|    .:||...|..   :.:.|.::.|...|   |:.:|...:..    :|....|..
Human  1122 AKSEPKT----QSPHSPKEES---ERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPTATGTF 1179

  Fly   345 GLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYVTDFAPSIAPMIPALIVHCVNEIEARG 409
            |:|..||| ..|.: ||                                ||.::..|...:|.||
Human  1180 GVRLDDCP-PAHTN-RY--------------------------------IPLIVDICCKLVEERG 1210

  Fly   410 LTEVGLYRLSSSEREYKALKEQFLRGKATPHLGN---TDIYVLCCCVKDFLRSLTEPLIPTSQWK 471
            |...|:||:..:.....:::|:..:|.|...:.:   .|:.|:...:|.|.|.|.|||....::.
Human  1211 LEYTGIYRVPGNNAAISSMQEELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYA 1275

  Fly   472 DFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIAQ-CPVVLMPIDNISLIFGPTI 535
            ||..|.:..|.......|.:.:..||:.:.:||.||..|.:.:|: .....|...|::::||||:
Human  1276 DFIEANRKEDPLDRLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTL 1340

  Fly   536 VGYS--------TPDPDQHAIYTEV-------FTQKQVMKALLELPVSFWEQYIVIDPTRTP--- 582
            |..|        |..|||:.|...:       ||::..     |.|::..::...:|....|   
Human  1341 VRTSEDNMTHMVTHMPDQYKIVETLIQHHDWFFTEEGA-----EEPLTTVQEESTVDSQPVPNID 1400

  Fly   583 --ATVIKRV---PSNKNDLLSLYATPFKG 606
              .|.|.|.   |.:.:|..:..:|..||
Human  1401 HLLTNIGRTGVSPGDVSDSATSDSTKSKG 1429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 14/54 (26%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 52/207 (25%)
ARHGAP21XP_011517904.1 PDZ_signaling 48..155 CDD:238492
PH_ARHGAP21-like 967..1076 CDD:269955 22/129 (17%)
PH 968..1073 CDD:278594 22/125 (18%)
RhoGAP_ARHGAP21 1178..1373 CDD:239860 56/228 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.