Sequence 1: | NP_610912.2 | Gene: | tum / 36538 | FlyBaseID: | FBgn0086356 | Length: | 625 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009293685.1 | Gene: | arhgap32b / 569434 | ZFINID: | ZDB-GENE-091204-147 | Length: | 1956 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 49/199 - (24%) |
---|---|---|---|
Similarity: | 86/199 - (43%) | Gaps: | 41/199 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 394 IPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDIYV--------LC 450
Fly 451 CCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVK---SVKQLPQANRDTLAFLILHFQ 512
Fly 513 RIAQCPVVL-MPIDNISLIFGPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLELPVSFWE---QY 573
Fly 574 IVID 577 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tum | NP_610912.2 | C1 | 319..367 | CDD:237996 | |
RhoGAP_MgcRacGAP | 381..570 | CDD:239847 | 45/187 (24%) | ||
arhgap32b | XP_009293685.1 | PX_domain | 124..238 | CDD:295365 | |
SH3_ARHGAP32_33 | 260..313 | CDD:212769 | |||
RhoGAP_CdGAP | 407..601 | CDD:239849 | 49/199 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3564 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |