DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and RhoGAP92B

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001287417.1 Gene:RhoGAP92B / 42371 FlyBaseID:FBgn0038747 Length:740 Species:Drosophila melanogaster


Alignment Length:553 Identity:120/553 - (21%)
Similarity:207/553 - (37%) Gaps:120/553 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 KSYGDINSTGSLLSDLSITHSEDDFLDVRTSKSWREHRPSLPKNQIPSVGNKRSRLSTGLNGSMS 205
            :.:..|......||..|.:.|:|..|:.      .|.:....::.|..:..|...||.| .||.|
  Fly     3 RQFAKIKIAAENLSRSSKSDSKDSELEA------IERQVDRYRDTIEKIVRKLPALSGG-GGSGS 60

  Fly   206 GTTPTTGKSRRSSVGIGVEQHTVDVGQGAERF------------CATTKVTIPQDGQGVIRAEST 258
            |::....|..:.:....:.|   .:.:.|:..            |...:.|:   .:.:|.:|..
  Fly    61 GSSEEQDKRTKKNSHYKIAQ---ALDESAKELPKDMPLQKVLANCGELEKTM---AECIIESELE 119

  Fly   259 IESLPVIAGNERIGDGLS------STPRRSV---LKEATAPPLTPVNAMAPHVVAESGTPLQHRP 314
            .|:..|    .|:.:.|.      ||.:|:|   |:|.|       :....|   |:...|:...
  Fly   120 TEAKVV----RRLKNILDKEIQEISTLKRNVSRTLQEYT-------SLKRSH---EAAIRLEEPA 170

  Fly   315 LMRNHTFSQ--------------------KTFLRGDNCVQCQKRIRFGAVGLRCRDCPVRCHIDC 359
            ...||..||                    :...:.|..|.|   ||...:..|........|::.
  Fly   171 AKVNHIKSQQEECELKLEKERDAWAAQMLELIAKEDEIVSC---IRDYVLNQRNYHERALQHVNA 232

  Fly   360 RYLLTVSCVPQTGTPTTKTMTG-----YVTDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRL- 418
                :::.:..|...|.|:..|     ::|.....|: .|..|...|:.|   .||.|.||.|: 
  Fly   233 ----SLARIQDTIQGTEKSRFGTSLKEHLTSTNREIS-YIVELCCCCLLE---HGLEEEGLLRVG 289

  Fly   419 --SSSEREYK-ALKEQFLRGKATP-HLGNTDIYVLCCCVKDFLRSLTEPLIPTSQWKDFANAVQN 479
              |:..|..| ||:.|.::   || .|...|.:|:...:|.:||.|.|||:..:.:|||....:.
  Fly   290 CASTKLRRMKHALEAQHVK---TPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAER 351

  Fly   480 PDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIAQCPVVL--MPIDNISLIFGPTI----VGY 538
            ......:..:...:.:||:.|...|.:| ..|..|.|....|  |...|::::..|.:    :..
  Fly   352 HSEAERKTEIKAILTKLPKENYANLRYL-TRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPRIDK 415

  Fly   539 STPDPDQHAIYTEVFTQKQVMKALLELPVSFWEQYIVIDPTRTPATVIK-------RVPSN---- 592
            |:..|   |.|............::||.:|.|: |..|.......|:.|       :..||    
  Fly   416 SSNAP---ADYIGQVNSSSAANIIVELLISQWD-YFFIGEVEFYLTLQKQKLFVEGKSKSNSSNE 476

  Fly   593 ---KNDLLSLYATPFKGGTIKKRKFYG-TPPAS 621
               :|| ..:..:| :.||::::|... :||.:
  Fly   477 NLDRND-SEVMESP-RYGTLRRQKANAPSPPTT 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 10/67 (15%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 53/204 (26%)
RhoGAP92BNP_001287417.1 BAR 27..257 CDD:299863 47/263 (18%)
RhoGAP_nadrin 245..452 CDD:239851 57/218 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.