DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and pik3r2

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_997987.2 Gene:pik3r2 / 404211 ZFINID:ZDB-GENE-040309-1 Length:724 Species:Danio rerio


Alignment Length:294 Identity:82/294 - (27%)
Similarity:114/294 - (38%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 FSQKTFLRGD---NCVQCQKRIRFGAVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGY 382
            |:::|..|||   ..||     ..|.|.|....|..|..      ..:..||:. .||.......
Zfish    59 FNERTKQRGDFPGTYVQ-----YVGP
VKLSAPYCQPRSQ------RPLPAVPRP-EPTASLQVVP 111

  Fly   383 VTDFA-----PSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKE-QFLRGKATPHL 441
            ..|..     |..||  |.|| ..:..:|..||....|||.|:|:.:..:|.| |.|      .:
Zfish   112 DLDLTKQFMHPETAP--PNLI-KLIEAVERSGLDCRTLYRTSASDNQRPSLSELQDL------DV 167

  Fly   442 GNTDIYVLCCCVKDFLRSLTEPLIPTSQWKDFANAVQ-NPDTKTA------QDMLVKSVKQLPQA 499
            |..||:.|...|..:|:.|..|:||...:.|...||| ..|..:.      |.:|.|  .::|..
Zfish   168 GQWDIHALSEAVIRYLQDLPAPIIPPCVYTDLQAAVQLESDVPSVRRRELLQQVLDK--PEVPLQ 230

  Fly   500 NRDTLAFLILHFQRIAQCPVVL-MPIDNISLIFGPTI----VGYSTPDPDQHAIYTEVFTQKQVM 559
            |..||.:|:.|..::.|..... :.|..:..||||.:    |..|..|        |.|....|.
Zfish   231 NLLTLHYLLQHLDKVCQSAEQNGLDIYTLGQIFGPLLFRGPVSGSEED--------EAFPAAAVE 287

  Fly   560 KALLELPVSFWEQYIVIDPTRTPATVIKRVPSNK 593
            :.|||   ..|||    :|  ||..:..:.|..|
Zfish   288 RLLLE---RIWEQ----EP--TPPALPPKPPKAK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 12/48 (25%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 58/206 (28%)
pik3r2NP_997987.2 SH3_PI3K_p85beta 6..79 CDD:212842 7/24 (29%)
RhoGAP 113..298 CDD:295372 61/210 (29%)
SH2_nSH2_p85_like 326..433 CDD:198195
PI3K_P85_iSH2 437..596 CDD:293063
iSH2_PIK3R2 438..598 CDD:214019
SH2_cSH2_p85_like 616..720 CDD:198184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.