DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and RhoGAP68F

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001261744.1 Gene:RhoGAP68F / 39385 FlyBaseID:FBgn0036257 Length:476 Species:Drosophila melanogaster


Alignment Length:214 Identity:52/214 - (24%)
Similarity:97/214 - (45%) Gaps:23/214 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 AVGLRCRDCPVR-CHIDCRYLLTVSCVPQTGTPT--------------TKTMTGYVTDFAPSIAP 392
            |:||.....|.. |.:|.:  |..|..|.|..|:              |....|....|....:|
  Fly   224 ALGLNKLKLP
DNICDLDDK--LNPSRKPSTPPPSSNINASRQQQHKMATTHQFGVPLKFIVMNSP 286

  Fly   393 ---MIPALIVHCVNEIEARGLTEV-GLYRLSSSEREYKALKEQFLRGKATPHLGNTDIYVLCCCV 453
               .||.::..||:.:...|:.:. |::|.|.:..|..||||:..||:.. .|.:.:::|:...:
  Fly   287 CLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDV-DLKSVNVHVIAGLL 350

  Fly   454 KDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIAQC- 517
            |.|||.|.|||:....::|....:..|..:.::::.....::||:.|.:...:::....|:..| 
  Fly   351 KSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCE 415

  Fly   518 PVVLMPIDNISLIFGPTIV 536
            .:..|...|::::|||..:
  Fly   416 DLNKMTSSNLAIVFGPNFL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 7/24 (29%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 40/161 (25%)
RhoGAP68FNP_001261744.1 SEC14 105..233 CDD:238099 3/8 (38%)
RhoGAP-p50rhoGAP 269..464 CDD:239869 41/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.