DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and ARHGAP40

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001157903.1 Gene:ARHGAP40 / 343578 HGNCID:16226 Length:674 Species:Homo sapiens


Alignment Length:570 Identity:105/570 - (18%)
Similarity:185/570 - (32%) Gaps:166/570 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RRCMQVLT-------------DGTPEEEFLRFLRMFEQYHEK----CA---------GYAAETAR 51
            |||.|...             |..|::..||.       |..    |:         |:..|..:
Human    34 RRCAQRWADLGCSSGPSSGRMDQLPQKNLLRL-------HPAGSAGCSTGVESSSMDGFWMEVEQ 91

  Fly    52 IQNELDKSLTKMGDLEGKLFHARRIIDMEIKARRQAEHERDAMESKIMAVADLL-------RHER 109
            ||...:......|..||:|                .|.|.::...:...::.||       .|:.
Human    92 IQQRDELREEDSGGNEGQL----------------PEGEAESQWLQDTGLSGLLGGLGLDGDHQE 140

  Fly   110 NLNNETRDKLAF----LHTLPSSRKRKSLNAVREDKSYGDINSTGSLLSDLSITHSEDDFLDVRT 170
            .|:..|:.::|.    |.....|.:|:....||:.:....:.::|.:.|:    :.:......:.
Human   141 LLSTLTQTQVAAVCRRLDIYARSVRRQHKTPVRDVRDVFGVFNSGKMSSE----NGDSGMKGAQL 201

  Fly   171 SKSWREHRPSLPKNQIPSVGNKRSRLSTGLNGSMSGTTPTTGKSRRSSVGIGVEQHTVDVGQGAE 235
            |....:..|:.....:.....:....:  ::.:.|.......:..|.|.|          |..|.
Human   202 SSGASKFPPAAEPGGLQEQAGREEAFN--MDSAYSEQAAVLLQRSRPSRG----------GTSAW 254

  Fly   236 RFCATTKVTIPQDGQGVIRAESTIESLPVIAGNERIGDGLSSTPRRSVLKEATAPPLTPVNAMAP 300
            ..|:..|.|:|:...||                .|||| ||....|.|      |.|..:...| 
Human   255 GKCSLPKFTVPKGRLGV----------------TRIGD-LSLQDMRKV------PSLALIELTA- 295

  Fly   301 HVVAESGTPLQHRPLMRNHTFSQKTFLRGDNCVQCQKRIRFGAVGLRCRDCPVRCHIDCRYLLTV 365
             :....|..|:.                       .|..::.|...|....|:...::..:.:  
Human   296 -LCDILGLDLKR-----------------------SKAGKWKAAETRLFGVPLDSLLEADHKV-- 334

  Fly   366 SCVPQTGTPTTKTMTGYVTDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKE 430
                   .|:|:             .|::...::.|   :|.|||...|:.|:..|:...|.|::
Human   335 -------LPSTQ-------------VPLVLQALLSC---LEKRGLDMEGILRVPGSQARVKGLEQ 376

  Fly   431 QFLRG--------KATPHLGNTDIYVLCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQD 487
            :..|.        ....|...:|:      :|.|:|.|..||:.......||.....|:.|....
Human   377 KLERDFYAGLFSWDEVHHNDASDL------LKRFIRKLPTPLLTAEYLPAFAVVPNIPNLKQRLQ 435

  Fly   488 MLVKSVKQLPQANRDTLAFLILHFQR--IAQCPVVLMPIDNISLIFGPTI 535
            :|...:..||:.||:.|..| |.|.|  :|:.....|.:.|:|.:..|.:
Human   436 VLHLLILILPEPNRNALKAL-LEFLRKVVAREQHNKMTLRNVSTVMAPNL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 4/47 (9%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 39/165 (24%)
ARHGAP40NP_001157903.1 RhoGAP 319..532 CDD:295372 42/198 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.