DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and RhoGAP15B

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster


Alignment Length:533 Identity:113/533 - (21%)
Similarity:191/533 - (35%) Gaps:160/533 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VADLLRHERNLNNETRDK--LAFL-HTLPSSRKRKSLNAVREDKSYGDINSTGSLLSDLSITHSE 162
            |.|:|:..:|.....|::  ..|| ..:.:.|:...|:.:          :|...:|:..:|.:.
  Fly   858 VEDILKEMQNRKAILRERQFQTFLDQEMKTPREMIPLDTI----------TTLQCVSNSRVTDTA 912

  Fly   163 DDF--LDVRTSKSWREHRPSLPKNQIPSVGNKRSRLSTGLNGSMSG------TTPTTGKSRRSSV 219
            ..|  .::.||:         |||     ||       |...:||.      |:.::|..::..|
  Fly   913 THFYCFEITTSQ---------PKN-----GN-------GAGDAMSSNPNLLMTSSSSGNVKQQRV 956

  Fly   220 GIGVEQHTVDVGQGAERFCATTKVTIPQDGQGVIRAESTIESLPV--IAGNERIGDGLSSTPRRS 282
                 .|...||:.:||.....|:           .||...||||  .....|.|        ..
  Fly   957 -----SHLYGVGKESERGVWMQKI-----------LESLTNSLPVKYTCHYYRAG--------WC 997

  Fly   283 VLKEATAPPLTPVNAMAPHVVAE-SGTPLQHRPLMRNHTF-------SQKTFLRGDNCVQCQKRI 339
            .||.:              :.:| |||.|..|...|...|       .:|..||...|:.     
  Fly   998 YLKNS--------------ITSEWSGTWLVLRKSQRRLIFVSEANGNVEKMDLRKARCIV----- 1043

  Fly   340 RFGAVGLRCRDCPV-RCHIDCRYLLTVSCVP------QTGTPTTKTMTGYVTDFAP----SIAPM 393
                  |:..|..: ..|::...:|.:.|.|      .:....||.....:.:.|.    |:...
  Fly  1044 ------LKESDESIDNLHVESGPMLMIDCPPYAVYMIMSSARETKIWRHIIREVAHNNGFSLGDQ 1102

  Fly   394 ------IPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDI------ 446
                  :|.::..|:|.:...|....|:||.|.||.....|...| |..|.    |.:|      
  Fly  1103 QLTRYDVPVIVDKCINFVYIHGSMSEGIYRKSGSENSMHKLMSAF-RADAF----NVEITRNEYN 1162

  Fly   447 -YVLCCCVKDFLRSLTEPLIPTSQWKD---FAN--AVQNPDTKTAQDMLVKSVKQLPQANRDTLA 505
             :.:...:|.|:|.|.|.|:  .:..|   |..  ||.:......:::|.:    |....|:||.
  Fly  1163 EHDVANVLKRFMRDLPERLL--GKLTDSFVFVTELAVASEKIPIYRELLAR----LSAIERETLR 1221

  Fly   506 FLILHFQRI-AQCPVVLMPIDNISLIFGPTIVG-------YSTPDPDQHA----IYTEVF----- 553
            .::.|...| :|.....|.:.|:::|:|||::.       ||..:.|..:    :|..:|     
  Fly  1222 RIVGHLVFISSQQAKNKMSVQNLTMIWGPTLLAKKSDELIYSQKEADVLSDLVVLYKNLFPCSAD 1286

  Fly   554 --TQKQVMKALLE 564
              .::|.|.|.|:
  Fly  1287 EIKREQAMLACLQ 1299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 9/55 (16%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 51/225 (23%)
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 44/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.