DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and Arhgap22

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_038950392.1 Gene:Arhgap22 / 306279 RGDID:1307237 Length:722 Species:Rattus norvegicus


Alignment Length:161 Identity:51/161 - (31%)
Similarity:82/161 - (50%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 FAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDIYVLC 450
            |.|.:||:   |:..||:.|..|||:|.||:|:.......:.|::.|..|:.......||::.:.
  Rat   189 FGPRLAPL---LVEQCVDFIRERGLSEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVA 250

  Fly   451 CCVKDFLRSLTEPLIPTSQWKDFANAVQ--NPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQR 513
            ..:|.:||.|.||:||.::::||.:..|  ..|.......|.|.|..|||||.:.|.::......
  Rat   251 SLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEGEGTVELAKQVSNLPQANYNLLRYICRFLDE 315

  Fly   514 I-AQCPVVLMPIDNISLIFGPTIVGYSTPDP 543
            : |...|..|.:.|::.:|||.|:.....||
  Rat   316 VQAHSDVNKMSVQNLATVFGPNILRPQVEDP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996
RhoGAP_MgcRacGAP 381..570 CDD:239847 51/161 (32%)
Arhgap22XP_038950392.1 PH-like 42..157 CDD:418428
RhoGAP_ARHGAP22_24_25 173..371 CDD:239855 51/161 (32%)
SMC_prok_B <614..>704 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.