DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and Arhgap8

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001004242.1 Gene:Arhgap8 / 300115 RGDID:1303143 Length:425 Species:Rattus norvegicus


Alignment Length:318 Identity:66/318 - (20%)
Similarity:121/318 - (38%) Gaps:64/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 RFGAVGLRCRDC-PVRCHIDCRYLLTV----------------SCVPQTGTPTTK---------T 378
            :||.....|.:. .:|.|:.|..||..                ...|.|.||..:         .
  Rat   131 KFGKKVTYCSNLRELREHLQCDQLLIPPEVVRYDEKLRNLHKGQTAPPTKTPPPRPPLPTQQFGV 195

  Fly   379 MTGYVTDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGN 443
            ...|:.|  .:...:||.::...|..:..:||...||:|.|:|.:..:.::..:.:||.......
  Rat   196 SLQYLRD--KNQGELIPPVLRWTVTYLREKGLHTEGLFRRSASAQTVRQVQRLYDQGKPVNFDDY 258

  Fly   444 TDIYVLCCCVKDFLRSLTEPLIPTSQWKDF--ANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAF 506
            .|:::....:|.|||.|.:||:....::..  ..:|::....|...::::|   ||:.|...|.:
  Rat   259 GDMHLPAVILKTFLRELPQPLLTFQAYEQILGITSVESSLRVTHCRLILRS---LPEHNYAVLRY 320

  Fly   507 LI--LH---FQRIAQCPVVLMPIDNISLIFGPTIVGYSTPDPDQHAIY-TEVFTQKQVMKALLEL 565
            |:  ||   .:.|:.    .|...|::.:||..::..|.......|:. ..:||         ||
  Rat   321 LMGFLHEVSLESISN----KMNSSNLACVFGLNLIWPSQGVASLSALVPLNLFT---------EL 372

  Fly   566 PVSFWEQYIVIDPTRTPATVIKRVPSNKNDLLSLYATPFKGGTIKKRKFYGTPPASAH 623
            .:.::::  |......|...|:.....|.          .|...|:....|||.||.:
  Rat   373 LIEYYDK--VFSAQEGPGEHIRDTVETKQ----------AGPVTKEFTQTGTPRASPY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 8/43 (19%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 43/196 (22%)
Arhgap8NP_001004242.1 SEC14 12..157 CDD:238099 8/25 (32%)
RhoGAP 191..381 CDD:413382 43/209 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.