DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and Myo9a

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_006511271.1 Gene:Myo9a / 270163 MGIID:107735 Length:2633 Species:Mus musculus


Alignment Length:229 Identity:58/229 - (25%)
Similarity:94/229 - (41%) Gaps:2/229 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 HTFSQKTFLRGDNCVQCQKRIRFGAVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYV 383
            |.|....:.....|..|...|........|:.|...||..|....|..|..:.....:....|..
Mouse  2075 HIFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACHKKCCLKTTAKCSKKYDPELSSRQFGVE 2139

  Fly   384 TDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDIYV 448
            .....|....:|.::...:|.||..||...|:||.|.|..:.|.|::.......:.:|.:.:|:|
Mouse  2140 LSRLTSEDRAVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTDAESVNLDDYNIHV 2204

  Fly   449 LCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQR 513
            :....|.:||.|..||:....:::|..|:...:.|.....:...:.||.:.:.:||..||.|..|
Mouse  2205 IASVFKQWLRDLPNPLMTFELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVR 2269

  Fly   514 IA-QCPVVLMPIDNISLIFGPTIVGY-STPDPDQ 545
            || |.....|..:.::::|.|.|:.. .|.||.|
Mouse  2270 IALQEDTNRMSANALAIVFAPCILRCPDTTDPLQ 2303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 11/47 (23%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 46/167 (28%)
Myo9aXP_006511271.1 RA_Myosin-IXa 15..110 CDD:340736
MYSc_Myo9 160..1006 CDD:276836
DUF5401 <968..>1283 CDD:375164
IQ 1117..1138 CDD:197470
PEHE <1827..1891 CDD:373705
C1 2075..2123 CDD:237996 11/47 (23%)
RhoGAP_myosin_IX 2136..2321 CDD:239842 46/168 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.