DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and chin-1

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_497323.3 Gene:chin-1 / 175268 WormBaseID:WBGene00015267 Length:421 Species:Caenorhabditis elegans


Alignment Length:307 Identity:80/307 - (26%)
Similarity:134/307 - (43%) Gaps:35/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 DGQGVIRAESTIESLPVIAGNERIGDGLSSTPRRSVLKEATAPPLTPVNAMAPHVVAESG----- 307
            |||..: .|...:::.::     :.|||.     |:..:..|...  :..||...:.|..     
 Worm   102 DGQFYV-GEKRFDTMDLL-----VADGLI-----SMFVDLHAADY--IKRMADEAIYEDSPYSRY 153

  Fly   308 -------TPLQHRPLMRNHTFSQKTFLRGDNCVQCQKRIRFGAV--GLRCRDCPVRCHIDCRYLL 363
                   :.:..||:.|.|.|:..||.....|..| :...:|.|  |:||.||....|..|....
 Worm   154 TNAAATTSDIVRRPVTRAHNFTSYTFKAPHYCDYC-RNFLWGLVHQGMRCEDCGFAAHKKCSEKT 217

  Fly   364 TVSCVPQTGTPTTKTMTGY-VTDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKA 427
            ...|||.  :...|.|.|. :|....:....:|.::..|:.|:|:|||...|:||:|.|....:.
 Worm   218 LHDCVPD--SKYVKRMFGVDITTLCMAHGADLPPIVPLCIGEVESRGLDVEGIYRVSGSYDHMEK 280

  Fly   428 LKEQFLRGKATPHLGNTDIYVLCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQD---ML 489
            ||:||...:........||:.:|..:|.:.|.|.:.|||.|..|....|.|..:.::..:   .:
 Worm   281 LKQQFDSNQYVDLATVCDIHTVCGLLKLYFRLLPQQLIPFSVHKQLLVAYQETNQRSTHERERQI 345

  Fly   490 VKSVKQLPQANRDTLAFLILHFQRIAQCPVV-LMPIDNISLIFGPTI 535
            .|.:.:|..||..||..::.|.:::|..... .|.::|::.||.||:
 Worm   346 RKVMMELSDANIITLGAVLAHLKKVADHSAKNKMTVENLATIFSPTL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 15/49 (31%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 45/160 (28%)
chin-1NP_497323.3 SH2_a2chimerin_b2chimerin 43..130 CDD:198215 8/38 (21%)
C1_1 172..224 CDD:278556 17/52 (33%)
RhoGAP 248..413 CDD:238090 43/145 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.