DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and hum-7

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_001248880.1 Gene:hum-7 / 171650 WormBaseID:WBGene00002040 Length:1880 Species:Caenorhabditis elegans


Alignment Length:250 Identity:65/250 - (26%)
Similarity:106/250 - (42%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 CVQCQKRIRFGAVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYVTD--------FAP 388
            |..|.:.|........|..|.:.||..|:..:|..|          .|||...|        |..
 Worm  1488 CEVCNQLIWHHEKLYTCVACRISCHKKCQPKVTHPC
----------QMTGKAIDPKTNGGRFFGA 1542

  Fly   389 SIAPM------IPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKE--QFLRGKATPHLGNTD 445
            |:..:      :|.|:......||.|.|...|:||.|.|..:.:::::  :......:.:|.:..
 Worm  1543 SLVSIVDDDHTVPTLLDRLFFAIETRALFVEGVYRKSGSLPQVRSIRKVIESTADADSVNLEDIG 1607

  Fly   446 IYVLCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILH 510
            ::||...||.|.|.|.||:|....:::|.|..:..|.......|...::.||:.||..|..|:.|
 Worm  1608 VHVLTTLVKAFFRELAEPIIIFDLYENFLNVSEVEDMGERVRCLSVMIELLPKPNRAVLDRLMYH 1672

  Fly   511 FQRIA-QCPVVLMPIDNISLIFGPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLE 564
            ..|:| |..|..|..:|::|||||.::........|..: .:|..|...::.|:|
 Worm  1673 LARVADQEAVNKMGCNNLALIFGPCVLRRQDSAHAQEQL-NDVARQTGCVQTLIE 1726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 9/34 (26%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 52/200 (26%)
hum-7NP_001248880.1 RA 28..134 CDD:214612
MYSc 163..936 CDD:214580
MYSc_Myo9 181..936 CDD:276836
C1 1234..1284 CDD:237996
C1 1475..1523 CDD:237996 9/34 (26%)
RhoGAP 1540..1727 CDD:295372 50/187 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.