DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and Myo9a

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_599162.2 Gene:Myo9a / 171296 RGDID:621395 Length:2626 Species:Rattus norvegicus


Alignment Length:229 Identity:58/229 - (25%)
Similarity:93/229 - (40%) Gaps:2/229 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 HTFSQKTFLRGDNCVQCQKRIRFGAVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYV 383
            |.|....:.....|..|...|........|:.|...||..|....|..|..:.....:....|..
  Rat  2068 HMFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACHKKCCLKTTAKCSKKYDPELSSRQFGVE 2132

  Fly   384 TDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDIYV 448
            .....|....:|.::...:|.||..||...|:||.|.|..:.|.|::.......:.:|.:.:|:|
  Rat  2133 LSRLTSEDRAVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTDAESVNLDDYNIHV 2197

  Fly   449 LCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQR 513
            :....|.:||.|..||:....:::|..|:...:.|.....:...:.||.:.:..||..||.|..|
  Rat  2198 IASVFKQWLRDLPNPLMTFELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLSTLERLIFHLVR 2262

  Fly   514 IA-QCPVVLMPIDNISLIFGPTIVGY-STPDPDQ 545
            || |.....|..:.::::|.|.|:.. .|.||.|
  Rat  2263 IALQEDTNRMSANALAIVFAPCILRCPDTTDPLQ 2296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 11/47 (23%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 46/167 (28%)
Myo9aNP_599162.2 Actin-binding. /evidence=ECO:0000250 908..919
Neck or regulatory domain. /evidence=ECO:0000250 1022..1163
Tail. /evidence=ECO:0000250 1164..2589 58/229 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1221..1276
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1360..1397
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1562..1602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1618..1673
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1689..1726
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1765..1784
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1872..1907
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2365..2385
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2449..2527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2552..2614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.