DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and RacGAP84C

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster


Alignment Length:271 Identity:131/271 - (48%)
Similarity:177/271 - (65%) Gaps:10/271 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 HRPLMRNHTFSQKTFLRG-DNCVQCQKRIRFGAVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPT 375
            |..|:|.|.|..|::... .|||.|:|||||....||||.||:||||.|...|||:|:||   |.
  Fly    80 HSGLLREHNFKIKSYYYNVGNCVHCRKRIRFAMASLRCRACPLRCHIGCCRQLTVNCIPQ---PQ 141

  Fly   376 TKTMTGYVTDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPH 440
            ..|..|.::|:||.:|||:||||||||.|||||||.:.||||:||:..:.|.|:.:.||||:|||
  Fly   142 IGTKRGCLSDYAPRVAPMVPALIVHCVTEIEARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPH 206

  Fly   441 LGNTDIYVLCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLA 505
            |||.|.:.||||||||||.|..||||....:||..|.::.|....:..:..:|.:|.||:|||||
  Fly   207 LGNKDTHTLCCCVKDFLRQLVHPLIPIYHRRDFEEATRHEDRLAVEMAVYLAVLELHQAHRDTLA 271

  Fly   506 FLILHFQRIAQCPVVLMPIDNISLIFGPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLELPVSFW 570
            :|:||:|:||:.|.|.|.::|:::||.||:.|      |.......|.|.::|:|.||.:|..||
  Fly   272 YLMLHWQKIAESPAVRMTVNNLAVIFAPTLFG------DLDLTLENVVTWQRVLKVLLLMPAGFW 330

  Fly   571 EQYIVIDPTRT 581
            .|::.:.|..|
  Fly   331 SQFLEVHPLPT 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 26/48 (54%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 92/188 (49%)
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556 27/51 (53%)
RhoGAP_MgcRacGAP 142..330 CDD:239847 93/193 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448731
Domainoid 1 1.000 143 1.000 Domainoid score I4591
eggNOG 1 0.900 - - E1_KOG3564
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S4674
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D184774at33208
OrthoFinder 1 1.000 - - FOG0004815
OrthoInspector 1 1.000 - - otm14660
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4412
SonicParanoid 1 1.000 - - X3396
109.730

Return to query results.
Submit another query.