DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and AgaP_AGAP013143

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_003436889.1 Gene:AgaP_AGAP013143 / 11175823 VectorBaseID:AGAP013143 Length:589 Species:Anopheles gambiae


Alignment Length:156 Identity:40/156 - (25%)
Similarity:72/156 - (46%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 ALIVHCVNEIEARGLTEVGLYRLSSSEREY-----------KALKEQFLRGKATPHLGNTDIY-- 447
            |.:..|::.:|.|||.|.||||:.....:.           |:.||:|...:....:|..||.  
Mosquito   387 AFVKKCIDILEQRGLEEEGLYRIGGVSTKINKLLQVGLDRKKSEKERFNFSQDEQFVGQGDILES 451

  Fly   448 -VLCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHF 511
             .:...:|.:||:|.|||:.......|.:|.:........:.:.:.|.:||:...|.|..:|.|.
Mosquito   452 KTIASALKQYLRNLDEPLMTYRLHHAFISAAKQETRLQRINEVHQLVYKLPKNRLDMLDMVIQHL 516

  Fly   512 QRIA-QCPVVLMPIDNISLIFGPTIV 536
            :.:: ......|.:.|:.::||||::
Mosquito   517 KAVSMNSDRNKMSVFNLGVVFGPTLL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996
RhoGAP_MgcRacGAP 381..570 CDD:239847 40/156 (26%)
AgaP_AGAP013143XP_003436889.1 BAR 20..223 CDD:299863
BAR-PH_GRAF_family 263..367 CDD:269953
PH 264..361 CDD:278594
RhoGAP 361..568 CDD:295372 40/156 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.