DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and RALBP1

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_006779.1 Gene:RALBP1 / 10928 HGNCID:9841 Length:655 Species:Homo sapiens


Alignment Length:258 Identity:68/258 - (26%)
Similarity:111/258 - (43%) Gaps:34/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 VPQTGTPTTKTMTGYVTDFAPSIAPM-----IPALIVHCVNEIEARGLTEVGLYRLSSSEREYKA 427
            |||...|..|.:.|.....|.....|     :||:...|::.:|..|:...|:||:|..:.:...
Human   178 VPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDE 242

  Fly   428 LKEQFLRGKATPHLGNTDIYVLCCCVKDFLRSLTEPLIPTSQWKDFANAV-QNPDTKTAQDMLVK 491
            ||..:.|.::| :|.:.:...:...:|.:||.|.|.|:.......|..|. :..:|:..|: ..:
Human   243 LKAAYDREEST-NLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKVQE-FQR 305

  Fly   492 SVKQLPQANRDTLAFLILHFQR-IAQCPVVLMPIDNISLIFGPTIVGYSTPDPDQHAIYT----- 550
            .:|:||:.|...:::||:|... ||:.....|.|.|||::..||:      ......:|.     
Human   306 LLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTV------QISNRVLYVFFTHV 364

  Fly   551 -EVF---TQKQVMKALLELPVSFWEQYIVIDPTRTPATV--IKRVPSNKNDLLSLYATPFKGG 607
             |:|   ..|||||.|.      |.....: || .|.|.  ||.....:..||:......:||
Human   365 QELFGNVVLKQVMKPLR------WSNMATM-PT-LPETQAGIKEEIRRQEFLLNCLHRDLQGG 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996
RhoGAP_MgcRacGAP 381..570 CDD:239847 52/204 (25%)
RALBP1NP_006779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q9PT60 102..119
Mediates association with membranes and could form transmembrane domains. /evidence=ECO:0000269|PubMed:15610018 154..219 11/40 (28%)
RhoGap_RalBP1 190..371 CDD:239846 46/188 (24%)
SMC_N <400..>627 CDD:330553 4/20 (20%)
Mediates interaction with RALA and RALB. /evidence=ECO:0000269|PubMed:20696399, ECO:0000269|PubMed:7673236 403..499 4/17 (24%)
Mediates interaction with REPS1 and REPS2. /evidence=ECO:0000250|UniProtKB:Q62796 500..655
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..551
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 601..655
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.