DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and sh3bp1

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_031756949.1 Gene:sh3bp1 / 101733422 XenbaseID:XB-GENE-984798 Length:636 Species:Xenopus tropicalis


Alignment Length:492 Identity:97/492 - (19%)
Similarity:187/492 - (38%) Gaps:129/492 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KMGDLEGKLFHARRIIDMEIKARRQAEHERD----AMESKIMAVADLLRHERNLNNETRDKLAFL 122
            |:..|.||     |::.. ::|...::.|:.    |:.|....:|:.|   :.:::|:|      
 Frog    43 KLAHLVGK-----RLVSC-LQAPAGSDREKKLKKLALSSLSWTMAECL---KEIDSESR------ 92

  Fly   123 HTLPSSRKRKSLNAVREDKSYGDINSTGSLLSDLSITHSEDDFLDVRTSKSWREHRPSLPKNQIP 187
                 .|:...:....|          |.|..||:      || ::...:...:....|.:..:|
 Frog    93 -----MRRTVEMGCCVE----------GILSQDLA------DF-EISLERDVLQPLAKLSEEDLP 135

  Fly   188 SVGNKRSRLSTGLNGSMSGTTPTTGKSRRSSVGIGVEQHTVDVGQGAERFCATTKVTIPQDGQGV 252
            ::...|.:|...:      |...|.|||.|.:     |..::.|||........|:...::.:..
 Frog   136 TILKHRKQLQKLI------TDWNTAKSRLSQI-----QKNINAGQGGGSTGTAAKLESLKEEEDE 189

  Fly   253 IRAESTIESLPVIAGNERIGDGLSSTPRRSVLKEATAPPLTPVNAMAPHVVAESGTPLQHRPLMR 317
            :|.:  :|.    :.:|.|.|..:.|.:.   ||.....:..:...|.:          |:..:.
 Frog   190 LRRK--LEQ----SKDEYIADLYNYTTKE---KECERYFIQLLELQAEY----------HKKSLS 235

  Fly   318 NHTFS-------QKTFLRGDNCVQCQKRIRFGAVGLRCRDCPVRCHI---DCRYLLTVSCVPQTG 372
            :.|.:       ||..:: |:..|....: :|.        |:..|:   :|...:.:|.     
 Frog   236 HLTDALEELKDLQKETVQ-DSIEQASAEV-YGV--------PLETHLAKFECEIAVPISA----- 285

  Fly   373 TPTTKTMTGYVTDFAPSIAPMIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKA 437
                                        ||..:.|:|:.|.||:||::.....|.|| ..||..|
 Frog   286 ----------------------------CVRMLLAQGMQEEGLFRLAAGASVLKKLK-ACLRAGA 321

  Fly   438 TPHLGN--TDIYVLCCCVKDFLRSLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQAN 500
            : .|.|  ::.:.:...:|.:||.|.|||:....:.|:.......|.:...:....:.|:||.||
 Frog   322 S-DLSNFMSEPHAVAGALKSYLRELPEPLMTYELFDDWMTCASTKDPEKRLECYRDACKKLPAAN 385

  Fly   501 RDTLAFLILHFQRIAQCPVV-LMPIDNISLIFGPTIV 536
            .:.|.:||....::|:...| .|...||:::.||.::
 Frog   386 YNNLRYLIKFMAKLAEHQEVNKMTPSNIAIVLGPNLL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 9/57 (16%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 41/159 (26%)
sh3bp1XP_031756949.1 BAR 16..250 CDD:416402 48/273 (18%)
RhoGAP 263..462 CDD:413382 46/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.