DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and chn2

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_002933428.2 Gene:chn2 / 100496459 XenbaseID:XB-GENE-950874 Length:467 Species:Xenopus tropicalis


Alignment Length:308 Identity:80/308 - (25%)
Similarity:143/308 - (46%) Gaps:22/308 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 ERIGDGLSSTPRRSVLKEAT--APPLTPVNAMAPH-VVAESGTPLQHRPLMRNHTFSQKTFLRGD 330
            ::|...||.|...|..|..|  :..:..:.::... .:|::.   .|....:.|.|...|| ||.
 Frog   164 DKITRRLSRTKNESKRKTVTNESKSVDKITSLVRRAAIAKND---NHFNYEKAHNFKVHTF-RGP 224

  Fly   331 N-CVQCQKRIRFG--AVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYVTDFAPSIAP 392
            : |..| ....:|  |.|:||.||.:..|..|...:...|.|.. ....|..:..:|....:...
 Frog   225 HWCEYC-ANFMWGLIAQGVRCSDCGLNVHKQCSKYVPNDCQPDL-KRIKKVYSCDLTTLVKAHNT 287

  Fly   393 MIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNT---DIYVLCCCVK 454
            ..|.::..|:.|||.|||...||||:|......:.:|..|.|......:.:|   ||.::...:|
 Frog   288 PRPMVVDMCIQEIEGRGLKSEGLYRVSGFTEHIEDVKMSFDRDGDRADISSTLYPDINIITGALK 352

  Fly   455 DFLRSLTEPLIPTSQWKDF--ANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIA-Q 516
            .:.|.|..|:|....:..|  |:.:.|.|.:.  :.:.:::..||.|:.:||.||::|.:::| .
 Frog   353 LYFRDLPIPVITYDTYYKFMEASKISNADERL--EAIHEALMLLPPAHYETLRFLMIHLKKVALN 415

  Fly   517 CPVVLMPIDNISLIFGPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLE 564
            ....||..:|:.::||||::  ..|:.:..|...::..|||:::.|::
 Frog   416 EKDNLMGSENLGIVFGPTLM--RPPEENALASLNDMRHQKQIVQLLIQ 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 17/50 (34%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 51/190 (27%)
chn2XP_002933428.2 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_betaCHN 209..269 CDD:410407 19/62 (31%)
RhoGAP_chimaerin 274..467 CDD:239837 51/192 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.