DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and syde2

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_002931720.3 Gene:syde2 / 100494956 XenbaseID:XB-GENE-980337 Length:1547 Species:Xenopus tropicalis


Alignment Length:186 Identity:54/186 - (29%)
Similarity:82/186 - (44%) Gaps:17/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 MIPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNT---DIYVLCCCVK 454
            |:|.|:..|:.|||.||...||||||..|....|.|:|.|.|...:..|..:   ||.|:...:|
 Frog  1192 MVPLLMDKCITEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKSVGLCESQYPDINVITGVLK 1256

  Fly   455 DFLRSLTEPLIPTSQWKDFANAVQNPDTKTA----------QDMLVKSVKQLPQANRDTLAFLIL 509
            |:||.|..|||....::....|:.....|.|          .:..|..:..||...:.||..|:.
 Frog  1257 DYLRELPSPLITKHLYEAVLKAMAEKPLKMASSGCENDSRDSENTVSLLDCLPDVEKATLKMLLD 1321

  Fly   510 HFQRIAQC-PVVLMPIDNISLIFGPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLE 564
            |.:.:|.. .|..|...|:::.|||.::. ...:...|  ...||...:.:.:.|:
 Frog  1322 HLKLVASYHEVNKMTCQNLAVCFGPVLLS-QRQETSSH--NNRVFIDSEELASALD 1374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996
RhoGAP_MgcRacGAP 381..570 CDD:239847 54/186 (29%)
syde2XP_002931720.3 C2 1041..1156 CDD:417471
RhoGAP 1176..1390 CDD:413382 54/186 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.