DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and fam13b

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_002933679.2 Gene:fam13b / 100492110 XenbaseID:XB-GENE-983583 Length:831 Species:Xenopus tropicalis


Alignment Length:253 Identity:57/253 - (22%)
Similarity:103/253 - (40%) Gaps:44/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 CHIDCRYLLTVSC--VPQTGTPTTKTMTGYVTDFAPSIAPMIPALIVHCVNEIEAR-GLTEVGLY 416
            |:|....:..:|.  :.|.|.|..:                :|.::.|.||.||.. ||.:.||:
 Frog    12 CNIIANKIFGISLAELQQEGQPDHE----------------VPFIVRHIVNYIEVHGGLEQEGLF 60

  Fly   417 RLSSSEREYKALKEQFLRGKATPHLGNTDIYVLCCCVKDFLRSLTEPLIPTSQW-------KDFA 474
            :::.:....:.|::::..|:....:...|:......::.||:.|.:|:|..|..       :||.
 Frog    61 QVNGNAETVEWLRQRYDNGEEVDLVKEADVPSAISLLRYFLQELPQPIILHSLHHRFMQLSQDFD 125

  Fly   475 NAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIAQCPVVLMPIDNISLIFGPTIVG-Y 538
            |  :|..::..|.:|    :|||..|...|.||......:|.....:.|...::.:|||.:.. |
 Frog   126 N--ENEFSRKLQYLL----QQLPSINYSLLKFLCRFLANVASNHEEMWPTTALAAVFGPDLFHIY 184

  Fly   539 STPDPDQHAIYTEVFTQKQVMKALLELPVSFWEQYIVIDPTRTPATVIKRVPSNKNDL 596
            |..|..:..|.|::.|      .|||....::|     ......:..|..:....|||
 Frog   185 SDDDMKEQEIVTKIMT------GLLERYCDYFE-----TEEEFSSNNISSITEQNNDL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 2/11 (18%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 46/197 (23%)
fam13bXP_002933679.2 RhoGAP 18..204 CDD:383032 48/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.