DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and dlc1

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_031751274.1 Gene:dlc1 / 100488460 XenbaseID:XB-GENE-482055 Length:1116 Species:Xenopus tropicalis


Alignment Length:474 Identity:88/474 - (18%)
Similarity:154/474 - (32%) Gaps:123/474 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NLNNETRDKLAFLHTLPSSRKRKSLNAVREDKSYGDINSTGSLL----SDLSITHSEDDFLDV-- 168
            ||:....:.::...:..||::|.|..:.....|..| |..|:||    |||:...:||.|.::  
 Frog   433 NLSFRRENSISSCKSSVSSQRRNSCCSEGSRLSIYD-NVPGTLLYSSNSDLADLENEDIFPELDD 496

  Fly   169 ---------RTSKSWREH----------------RPSLPKNQIPSVGNKRSRLSTGLNGSMSGTT 208
                     |....|.|.                .||.||.....:.|..:.||         ..
 Frog   497 ILYHVKGMQRIVNQWSEKFYDEGDSDSALDSVSPCPSSPKQIHLDIDNDCNALS---------DL 552

  Fly   209 PTTGKSRRSSVGIGVEQHTVDVGQGAERFCATTKVTIPQDGQGVIRAESTIESLPVIAGNERIGD 273
            .:||.|........|.|...|.|.||         ::.:..:...|..|                
 Frog   553 DSTGNSFNDCEEATVIQARRDSGVGA---------SLTRTNRHRFRWHS---------------- 592

  Fly   274 GLSSTPRRSVLK---EATAPPLTPVNAMAPHVVAESGTPLQHRPLMRNHTFSQKT--FLRGDNCV 333
             ..|:.|.|:..   :.....:|.:|.:..:.:.:....|:.......|.||...  |::.....
 Frog   593 -FQSSHRPSLSSASLQMNCQSVTQINLLQKYSLLKLTALLEKYTPSNKHGFSWAVPKFMKRVKVP 656

  Fly   334 QCQKRIRFGAVGLRCRDCPVRCHIDCRYLLTVSCVPQTGTPTTKTMTGYVTDFAPSIAPMIPALI 398
            ..:.|..||.        |:..:           |.:||.|                   :|..|
 Frog   657 DYKDRNVFGV--------PLAIN-----------VQRTGQP-------------------LPQSI 683

  Fly   399 VHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDIYVLCCCVKDFLRSLTEP 463
            ...:..:.::.|.:|||:|.|..:....||:|.......:........|.:...:|.:.|.|.||
 Frog   684 QLAMRYLRSQCLDQVGLFRKSGVKSRILALREISENNNDSLTYEGQSAYDVADMLKQYFRDLPEP 748

  Fly   464 LIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIAQCPVVLMPID--- 525
            |:.:...:.|....|....:.....:..::..||..||:.|..|:.....:|..      :|   
 Frog   749 LLTSKLSETFLQIYQYVPKEQRLQAIKAAIMLLPDENREVLQTLLYFLSDVAAA------VDENQ 807

  Fly   526 ----NISLIFGPTIVGYST 540
                |:::...|::...:|
 Frog   808 MTPTNLAVCLAPSLFHLNT 826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996 8/49 (16%)
RhoGAP_MgcRacGAP 381..570 CDD:239847 31/167 (19%)
dlc1XP_031751274.1 SAM_superfamily 39..102 CDD:417767
RhoGAP_DLC1 660..878 CDD:239840 39/211 (18%)
SRPBCC 908..1106 CDD:417480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.