DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and ralbp1

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_017950523.1 Gene:ralbp1 / 100379815 XenbaseID:XB-GENE-1016073 Length:673 Species:Xenopus tropicalis


Alignment Length:143 Identity:38/143 - (26%)
Similarity:71/143 - (49%) Gaps:2/143 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 IPALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDIYVLCCCVKDFLR 458
            :||:...|::.||..|:...|:||:|..:.:...||..:.||: :|:|.:.:.|.:...:|.:||
 Frog   204 LPAVFRECIDYIEQHGMKCEGIYRVSGIKSKVDELKAAYDRGE-SPNLEDYEPYTVASLLKQYLR 267

  Fly   459 SLTEPLIPTSQWKDFANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIAQCPV-VLM 522
            .|.|.::.......|..|..............:.:|:||:.|....::||:|...:.:..: ..|
 Frog   268 ELPENVLTKDLMPRFEEACGKSTEGERLQECQRLLKELPECNFCLTSWLIVHMDHVIEKELETKM 332

  Fly   523 PIDNISLIFGPTI 535
            .|.|||::..||:
 Frog   333 NIQNISIVLSPTV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996
RhoGAP_MgcRacGAP 381..570 CDD:239847 38/143 (27%)
ralbp1XP_017950523.1 RhoGap_RalBP1 185..366 CDD:239846 38/143 (27%)
SMC_prok_B <390..>571 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.