DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and arhgap17b

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_009297597.1 Gene:arhgap17b / 100141341 ZFINID:ZDB-GENE-080220-26 Length:790 Species:Danio rerio


Alignment Length:264 Identity:58/264 - (21%)
Similarity:110/264 - (41%) Gaps:67/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 CVNEIEARGLTEVGLYRLSSSEREYKALK----------EQFLRGKATPHLGNTDIYVLCCCVKD 455
            ||..:...|:.|.||:|:::...:.|.||          |:|.          :|.:.:...:|.
Zfish   276 CVMMLLETGMQEEGLFRIAAGASKLKKLKAALDCSTSQLEEFY----------SDPHAVAGALKS 330

  Fly   456 FLRSLTEPLIPTSQWKDF--ANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRIA-QC 517
            :||.|.|||:....::::  |:.:.:|| |..|.:.| ....||:||:....:|:....::| :.
Zfish   331 YLRELPEPLMSYQLYEEWIQASNISDPD-KRLQALWV-VCDMLPKANKTNFRYLVKFLAKLALES 393

  Fly   518 PVVLMPIDNISLIFGPTIVGYSTPDPDQHAIYTEVFTQKQVMKALLELPVSF--W---------- 570
            .|..|...||:::.||.::...|    :.::.....|....:.:::||.::.  |          
Zfish   394 DVNKMTASNIAIVLGPNLLWAKT----EGSLAEMAATTSVHVVSIIELIINHAGWFFPGDVDFNV 454

  Fly   571 --------------EQYIVIDPTRTPA-------TVIKRVPSNKNDLLSLYATPFKGGTIKKRKF 614
                          .:|..|:..|..:       |..|..|:||....:    |.:.|||.|:: 
Zfish   455 SGVFAMPGCPGTPDVEYGTIERRRPGSQGSLDSDTARKDSPANKQPEFA----PRRTGTITKKQ- 514

  Fly   615 YGTP 618
            :.||
Zfish   515 HSTP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996
RhoGAP_MgcRacGAP 381..570 CDD:239847 42/183 (23%)
arhgap17bXP_009297597.1 BAR_Rich1 14..261 CDD:153302
RhoGAP_nadrin 250..450 CDD:239851 43/189 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.