DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tum and arhgap22

DIOPT Version :9

Sequence 1:NP_610912.2 Gene:tum / 36538 FlyBaseID:FBgn0086356 Length:625 Species:Drosophila melanogaster
Sequence 2:XP_002940376.2 Gene:arhgap22 / 100127847 XenbaseID:XB-GENE-5807514 Length:544 Species:Xenopus tropicalis


Alignment Length:201 Identity:51/201 - (25%)
Similarity:92/201 - (45%) Gaps:17/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 PALIVHCVNEIEARGLTEVGLYRLSSSEREYKALKEQFLRGKATPHLGNTDIYVLCCCVKDFLRS 459
            |.::..||:.|...||.|.||:||.......|.|::.|..|.......:||::.:...:|.:||.
 Frog    71 PLVVEQCVDFIRENGLQEEGLFRLPGQATLVKELQDTFDSGGKPTFDKSTDVHTVASLLKLYLRE 135

  Fly   460 LTEPLIPTSQWKDF---ANAVQNPDTKTAQDMLVKSVKQLPQANRDTLAFLILHFQRI-AQCPVV 520
            |.||:||.|:::||   |:.:.....:..|::.: .:|.||..|.:.|.::......: :.....
 Frog   136 LPEPVIPFSRYQDFLRCAHILSGDQGEGTQELSI-LIKSLPPVNYNLLKYICSFLDEVQSYSDTN 199

  Fly   521 LMPIDNISLIFGPTIVGYSTPDP---------DQHAIYTEVFTQKQVMKAL-LELPVSFWEQYIV 575
            .|.:.|::.:|.|.|:.....||         .||.:...:.....:.:|: .:.||....|.  
 Frog   200 KMNVQNLATVFAPNILRPKQQDPVALIEGASLIQHLLTILIHENHWIFQAVSADSPVGVSVQQ-- 262

  Fly   576 IDPTRT 581
            ||.|::
 Frog   263 IDNTQS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tumNP_610912.2 C1 319..367 CDD:237996
RhoGAP_MgcRacGAP 381..570 CDD:239847 47/188 (25%)
arhgap22XP_002940376.2 PH-like <16..52 CDD:388408
RhoGAP 53..247 CDD:383032 44/176 (25%)
Myosin_tail_1 <446..>521 CDD:366712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.