DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6553 and SORL1

DIOPT Version :10

Sequence 1:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_003096.2 Gene:SORL1 / 6653 HGNCID:11185 Length:2214 Species:Homo sapiens


Alignment Length:266 Identity:77/266 - (28%)
Similarity:97/266 - (36%) Gaps:99/266 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NATSCGH-------RCGGGDCIQLDQLCDGSANCLDGSDETVAMCEKVWCPGYAFRCSYGACIAS 85
            |.|:..|       :|..|.||.....|||..:|.|||||....|||. |.|  |||..|.||.|
Human  1191 NCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKK-CNG--FRCPNGTCIPS 1252

  Fly    86 TAVCDGVQDCVDGSDEQGW--LCRAQMQQANCDNWEMYCSSGQCMTYSKLCDGIRDCRDGDD--- 145
            :..|||::||.||||||..  ||...|... |.|.:      ||:.:|.:||||..||||.|   
Human  1253 SKHCDGLRDCSDGSDEQHCEPLCTHFMDFV-CKNRQ------QCLFHSMVCDGIIQCRDGSDEDA 1310

  Fly   146 ---------ELESLCE--------GVTIPTTTVSSTTSTTTESSIHRITPTVPVTRKASRPNPLQ 193
                     |...:|:        ||.|.............:.|           .:|:..||.:
Human  1311 AFAGCSQDPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYS-----------DEANCENPTE 1364

  Fly   194 ------------ENGECVVPQLPNVMVKHFTDAILTVGSRVANGTRIYYDCPAEHRLKGENQNIC 246
                        |||.|:    ||                               |.|.:.:|.|
Human  1365 APNCSRYFQFRCENGHCI----PN-------------------------------RWKCDRENDC 1394

  Fly   247 QDALWA 252
            .|  |:
Human  1395 GD--WS 1398

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG6553NP_610911.1 LDLa 34..60 CDD:197566 12/32 (38%)
LDLa 70..101 CDD:197566 17/30 (57%)
LDLa 115..146 CDD:197566 14/42 (33%)
SORL1NP_003096.2 Cell attachment site. /evidence=ECO:0000255 63..65
VPS10 124..753 CDD:214740
BNR 1 136..147
BNR 2 232..243
BNR 3 441..452
BNR 4 521..532
BNR 5 562..573
LY 780..821 CDD:214531
LDL-receptor class B 1 800..843
LY 824..866 CDD:214531
LDL-receptor class B 2 844..887
LY 868..910 CDD:214531
LDL-receptor class B 3 888..932
Ldl_recept_b 890..929 CDD:459654
LY 913..953 CDD:214531
LDL-receptor class B 4 933..970
LY 953..993 CDD:214531
LDL-receptor class B 5 971..1013
LDLa 1078..1112 CDD:238060
LDLa 1120..1153 CDD:238060