DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6553 and ImpE1

DIOPT Version :10

Sequence 1:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_524849.2 Gene:ImpE1 / 45879 FlyBaseID:FBgn0001253 Length:1616 Species:Drosophila melanogaster


Alignment Length:150 Identity:50/150 - (33%)
Similarity:68/150 - (45%) Gaps:17/150 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CLGSQNATSC-GHRCG----------GGDCIQLDQLCDGSANCLDGSDETVAMCEKV--WCPGYA 74
            |...:..:.| ..|.|          .|.||....:|||.|:|.|.|||......::  .||..:
  Fly  1388 CAAGEEGSQCSAERTGCSPGTFQCRSSGVCISWFFVCDGRADCNDASDEECTHNARLNQTCPTES 1452

  Fly    75 FRCS-YGACIASTAVCDGVQDCVDGSDEQGWLCRAQMQQAN-CDNWEMYCSSGQCMTYSKLCDGI 137
            |||. .|.||:..|:|||.:.|..|.||.|  |...::..| |......|.||:|:...:.|:.|
  Fly  1453 FRCQRSGRCISRAALCDGRRQCPHGEDELG--CDGSVKGGNACPEHTFRCGSGECLPEYEYCNAI 1515

  Fly   138 RDCRDGDDELESLCEGVTIP 157
            ..|:||.||...||....:|
  Fly  1516 VSCKDGSDEPPHLCGSRALP 1535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6553NP_610911.1 LDLa 34..60 CDD:197566 12/35 (34%)
LDLa 70..101 CDD:197566 14/31 (45%)
LDLa 115..146 CDD:197566 10/30 (33%)
ImpE1NP_524849.2 EB 75..131 CDD:460294
rne <795..981 CDD:236766
LDLa 1404..1437 CDD:238060 11/32 (34%)
LDLa 1448..1483 CDD:238060 17/36 (47%)
LDLa 1493..1524 CDD:238060 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.