DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6553 and LRP5

DIOPT Version :10

Sequence 1:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_011543331.1 Gene:LRP5 / 4041 HGNCID:6697 Length:1662 Species:Homo sapiens


Alignment Length:206 Identity:61/206 - (29%)
Similarity:77/206 - (37%) Gaps:47/206 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QNATSCGH---------RCGGG--DCIQLDQLCDGSANCLDGSDETVAMCEKVWCPGYAFRCSYG 80
            ||..:||.         .|..|  |||.....|||...|.|.|||.....    |....|.|:.|
Human  1257 QNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPV----CSAAQFPCARG 1317

  Fly    81 ACIASTAVCDGVQDCVDGSDEQGWLCRAQMQQANCD-----NWEMYCSSGQCMTYSKLCDGIRDC 140
            .|:.....|||..||.|.|||           |:||     | :..|:||||:...:.||...||
Human  1318 QCVDLRLRCDGEADCQDRSDE-----------ADCDAICLPN-QFRCASGQCVLIKQQCDSFPDC 1370

  Fly   141 RDGDDELESLCEGVTIPTTTVSSTTSTT------------TESSIHRITPTVPVTRKASRPNPLQ 193
            .||.|||  :|| :|.|.:..|...|:.            ....::.:...|...|.|....|..
Human  1371 IDGSDEL--MCE-ITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFP 1432

  Fly   194 ENGECVVPQLP 204
            .......|.:|
Human  1433 HEYVSGTPHVP 1443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6553NP_610911.1 LDLa 34..60 CDD:197566 11/36 (31%)
LDLa 70..101 CDD:197566 12/30 (40%)
LDLa 115..146 CDD:197566 14/35 (40%)
LRP5XP_011543331.1 YncE 34..223 CDD:442618
LY 111..151 CDD:214531
Ldl_recept_b 172..212 CDD:459654
LY 196..238 CDD:214531
LY 239..273 CDD:214531
FXa_inhibition 308..345 CDD:464251
LY 375..415 CDD:214531
LY 417..459 CDD:214531
LY 460..503 CDD:214531
LY 504..546 CDD:214531
LY 547..580 CDD:214531
FXa_inhibition 614..649 CDD:464251
NHL 694..887 CDD:302697
LY 719..761 CDD:214531
NHL repeat 729..765 CDD:271320
LY 762..805 CDD:214531
NHL repeat 772..811 CDD:271320
NHL repeat 856..880 CDD:271320
FXa_inhibition 915..950 CDD:464251
LY 979..1018 CDD:214531
LY 1069..1112 CDD:214531
LY 1113..1155 CDD:214531
FXa_inhibition 1226..1262 CDD:464251 2/4 (50%)
Ldl_recept_a 1267..1304 CDD:395011 13/36 (36%)
LDLa 1307..1341 CDD:238060 15/44 (34%)
LDLa 1345..1379 CDD:238060 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.