DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6553 and F14B4.1

DIOPT Version :10

Sequence 1:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_492474.2 Gene:F14B4.1 / 172750 WormBaseID:WBGene00008779 Length:722 Species:Caenorhabditis elegans


Alignment Length:136 Identity:40/136 - (29%)
Similarity:59/136 - (43%) Gaps:33/136 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IC-LGSQNATSCGHRCGGGDCIQLDQLCDG---SANCLDGSDETVAMCEKVWCPGYAFRCSYGAC 82
            :| ||...|.:|.  ||.|    .|.|.||   |:||.:...|         |.|     :...|
 Worm   592 LCLLGENGAATCA--CGEG----FDLLNDGKKCSSNCSESQIE---------CGG-----ADPKC 636

  Fly    83 IASTAVCDGVQDCVDGSDEQGWLCRAQMQQANCDNWEMYC-SSGQCMTYSKLCDGIRDCRDGDDE 146
            |:...:|||:..|.:.:||:  .|..::    |...:..| .:.:|:....|||.:.||.|..||
 Worm   637 ISKIYLCDGLAQCSNQADEE--KCPPRI----CLPGQFQCHDNHKCLPPGGLCDKVTDCSDSSDE 695

  Fly   147 LESLCE 152
            :  .||
 Worm   696 I--YCE 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6553NP_610911.1 LDLa 34..60 CDD:197566 10/28 (36%)
LDLa 70..101 CDD:197566 8/30 (27%)
LDLa 115..146 CDD:197566 9/31 (29%)
F14B4.1NP_492474.2 vWFA <272..313 CDD:469594
LY 343..383 CDD:214531
LY 391..425 CDD:214531
Ldl_recept_b 448..487 CDD:459654
LY 470..512 CDD:214531
LY 513..549 CDD:214531
FXa_inhibition 588..618 CDD:464251 12/31 (39%)
LDLa 622..658 CDD:238060 12/51 (24%)
LDLa 663..698 CDD:238060 11/36 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.