DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6553 and LDLRAD3

DIOPT Version :10

Sequence 1:NP_610911.1 Gene:CG6553 / 36537 FlyBaseID:FBgn0033880 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_777562.1 Gene:LDLRAD3 / 143458 HGNCID:27046 Length:345 Species:Homo sapiens


Alignment Length:169 Identity:57/169 - (33%)
Similarity:73/169 - (43%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVIFLSLAVTICL--GSQNATSC----GHRCGGGDCIQLDQLCDGSANCLDGSDETVAMCEKVWC 70
            |.:.||.|....|  |:.....|    ...|..|.||.....|||..:|.|.|||......|..|
Human     7 LCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSKC 71

  Fly    71 PGYAFRCSYGA-CIASTAVCDGVQDCVDGSDEQGWLCRAQMQQANCDNWEMYCSSGQCMTYSKLC 134
            ....|.|:.|. ||.....|:|.:||.|||||:.  |.|  ....|.....:|.:|.|:..|.:|
Human    72 GPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEEN--CTA--NPLLCSTARYHCKNGLCIDKSFIC 132

  Fly   135 DGIRDCRDGDDELESLCEGVTIPTTTVSSTTSTTTESSI 173
            ||..:|:|..|| || ||....|.   |.....|:|:.:
Human   133 DGQNNCQDNSDE-ES-CESSQEPG---SGQVFVTSENQL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6553NP_610911.1 LDLa 34..60 CDD:197566 10/25 (40%)
LDLa 70..101 CDD:197566 13/31 (42%)
LDLa 115..146 CDD:197566 10/30 (33%)
LDLRAD3NP_777562.1 (Microbial infection) Interaction with Venezuelan equine encephalitis virus/VEEV spike proteins E1 and E2. /evidence=ECO:0000269|PubMed:34646021 30..57 8/26 (31%)
LDLa 32..64 CDD:238060 12/31 (39%)
LDLa 71..106 CDD:238060 15/36 (42%)
LDLa 113..147 CDD:238060 14/35 (40%)
Involved in ITCH interaction. /evidence=ECO:0000269|PubMed:26854353 256..259
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..345
Involved in ITCH interaction. /evidence=ECO:0000269|PubMed:26854353 275..278
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.